HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    HIV1U12999		     252 bp    RNA     linear	VRL 20-JUL-1995
DEFINITION  Human immunodeficiency virus type 1, isolate K985 from Kenya,
	    envelope glycoprotein (env) gene v3 region, partial cds
ACCESSION   U12999
VERSION     U12999.1 GI:576714
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 252)
            Show all sequences for reference 1
  AUTHORS   Janssens,W., Heyndrickx,L., Fransen,K., Temmerman,M., Leonaers,A.,
	    Ivens,T., Motte,J., Piot,P. and van der Groen,G.
  TITLE     Genetic variability of HIV type 1 in Kenya
  JOURNAL   AIDS Res. Hum. Retroviruses 10 (11), 1577-1579 (1994)
  PUBMED    7888213
REFERENCE   2 (bases 1 to 252)
            Show all sequences for reference 2
  AUTHORS   Bryant,B.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-AUG-1994) Bart W. Bryant, Los Alamos National
	    Laboratory, HIV Sequence Database, T-10, Mail Stop K710, Los
	    Alamos, NM 87545, USA
COMMENT     V3-ID: A_KE.KEN-ID These patients were part of a 1990-1992 cohort
	    study of maternal risk factors in mother to child transmission.
	    This patient is one of twenty-two seropositive pregnant women in
	    this study, which also includes an infected infant. GenBank
	    accession numbers for the entire set of 23 patients surveyed in
	    this study: U12984--U13006.
FEATURES             Location/Qualifiers
     source	     1..252
		     /organism="Human immunodeficiency virus 1"
		     /mol_type="genomic RNA"
		     /isolate="K985"
		     /db_xref="taxon:11676"
     gene	     1..252
		     /gene="env"
     CDS	     <1..>252
		     /gene="env"
		     /codon_start="1"
		     /transl_table="1"
		     /product="envelope glycoprotein, v3 region"
		     /protein_id="AAA70072.1"
		     /db_xref="GI:576715"
		     /translation="EEVVIRSENITNNVKTIIVQLVEPVIINCTRPNNNTRKSIRIGP
		     GQTFYAGEIIGNIRQAHCNVSRSKWNNTLQKVATQLREHF"
BASE COUNT	111 a	  38 c	   43 g     60 t
ORIGIN
       1 gaagaggtag tcattagatc tgaaaatatc acaaacaatg tcaaaactat aatagtacaa 
      61 cttgtcgagc ctgtgataat taattgtacc agacctaaca acaatacaag aaaaagtata 
     121 cgtataggac caggacaaac attctatgca ggtgaaataa tagggaatat aagacaagca 
     181 cattgtaatg tcagtagatc aaaatggaat aatactttac aaaaggtagc tacacaatta 
     241 agagaacact tt
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health