View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIV1U12999 252 bp RNA linear VRL 20-JUL-1995
DEFINITION Human immunodeficiency virus type 1, isolate K985 from Kenya,
envelope glycoprotein (env) gene v3 region, partial cds
ACCESSION U12999
VERSION U12999.1 GI:576714
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 252)
Show all sequences for reference 1
AUTHORS Janssens,W., Heyndrickx,L., Fransen,K., Temmerman,M., Leonaers,A.,
Ivens,T., Motte,J., Piot,P. and van der Groen,G.
TITLE Genetic variability of HIV type 1 in Kenya
JOURNAL AIDS Res. Hum. Retroviruses 10 (11), 1577-1579 (1994)
PUBMED 7888213
REFERENCE 2 (bases 1 to 252)
Show all sequences for reference 2
AUTHORS Bryant,B.W.
TITLE Direct Submission
JOURNAL Submitted (04-AUG-1994) Bart W. Bryant, Los Alamos National
Laboratory, HIV Sequence Database, T-10, Mail Stop K710, Los
Alamos, NM 87545, USA
COMMENT V3-ID: A_KE.KEN-ID These patients were part of a 1990-1992 cohort
study of maternal risk factors in mother to child transmission.
This patient is one of twenty-two seropositive pregnant women in
this study, which also includes an infected infant. GenBank
accession numbers for the entire set of 23 patients surveyed in
this study: U12984--U13006.
FEATURES Location/Qualifiers
source 1..252
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="K985"
/db_xref="taxon:11676"
gene 1..252
/gene="env"
CDS <1..>252
/gene="env"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein, v3 region"
/protein_id="AAA70072.1"
/db_xref="GI:576715"
/translation="EEVVIRSENITNNVKTIIVQLVEPVIINCTRPNNNTRKSIRIGP
GQTFYAGEIIGNIRQAHCNVSRSKWNNTLQKVATQLREHF"
BASE COUNT 111 a 38 c 43 g 60 t
ORIGIN
1 gaagaggtag tcattagatc tgaaaatatc acaaacaatg tcaaaactat aatagtacaa
61 cttgtcgagc ctgtgataat taattgtacc agacctaaca acaatacaag aaaaagtata
121 cgtataggac caggacaaac attctatgca ggtgaaataa tagggaatat aagacaagca
181 cattgtaatg tcagtagatc aaaatggaat aatactttac aaaaggtagc tacacaatta
241 agagaacact tt
//
last modified: Tue May 31 10:56 2022