View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIV1U08360 678 bp DNA linear VRL 26-AUG-1996
DEFINITION HIV-1 RU107A from Russia, gp120 V3-V5 region (env) gene, partial
cds
ACCESSION U08360
VERSION U08360.1 GI:533443
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 678)
Show all sequences for reference 1
AUTHORS Bobkov,A., Cheingsong-Popov,R., Garaev,M., Rzhaninova,A.,
Kaleebu,P., Beddows,S., Bachmann,M.H., Mullins,J.I., Louwagie,J.,
Janssens,W., van der Groen,G., McCutchan,F. and Weber,J.
TITLE Identification of an env G subtype and heterogeneity of HIV-1
strains in the Russian Federation and Belarus
JOURNAL AIDS 8 (12), 1649-1655 (1994)
PUBMED 7888112
REFERENCE 2 (sites)
Show all sequences for reference 2
AUTHORS Bobkov,A., Cheingsong-Popov,R., Garaev,M. and Weber,J.
TITLE Glycoprotein 120 polymorphism in an HIV type 1 epidemic originating
from a point source: nucleotide sequence analysis of variants with
conserved V3 loop sequences
JOURNAL AIDS Res. Hum. Retroviruses 12 (3), 251-253 (1996)
PUBMED 8835204
REFERENCE 3 (bases 1 to 678)
Show all sequences for reference 3
AUTHORS Bobkov,A.F.
TITLE Direct Submission
JOURNAL Submitted (05-APR-1994) Aleksei F. Bobkov, The DI Ivanovsky
Institute of Virology, Department of Molecular Virology, 16
Gamaleya Street, Moscow, 123098, Russia
COMMENT One of the earliest detected cases of HIV-1 Group M in the former
French colonies came from the town of Brazzaville, Congo across the
river from Kinshasa, DRC, where a Soviet man received an
HIV-1-infected blood transfusion in 1981. The HIV-infected child of
this man was subsequently admitted to a hospital in Elista,
Georgia, where the reuse of unsterilised needles led to one of the
worlds worst nosocomial outbreaks of HIV infection, with another
57 infants infected by the end of the eighties [M. Smallman-Raynor,
A. Cliff and P. Haggett, Atlas of AIDS (London: Blackwell, 1992),
pages 332-334.]
FEATURES Location/Qualifiers
source 1..678
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/strain="RU107A"
/db_xref="taxon:11676"
gene 1..678
/gene="env"
CDS <1..>678
/gene="env"
/note="V3-V5 region"
/codon_start="1"
/transl_table="1"
/product="gp120"
/protein_id="AAC55344.1"
/db_xref="GI:533444"
/translation="RSENFTDNAKVIIVQLNKSVEIICTRPNNNTRKSIHFGPGQALY
ATGEIIGDIRQAHCNVSRKDWNEMLQNVTTKLKEIFDNRTITFNSAAGGDLEITTHSF
NCRGEFFYCNTSGLFNNSKTNSTITLPCRIKQIIRMWQRVGQAMYAPPIAGNITCISN
ITGLLLTRDGGNNNNSTNETFRPGGGDMRDNWRSELYKYKVVRIKPLGVAPTRARRRV
VGGEKRAV"
BASE COUNT 275 a 106 c 144 g 153 t
ORIGIN
1 agatctgaaa acttcacaga caatgccaaa gtcataatag tgcagcttaa taaatctgta
61 gaaattatat gtactagacc caataacaat acaagaaaaa gtatacattt cggaccagga
121 caagcgctct atgcaacagg tgaaataata ggagatataa gacaagcaca ttgtaatgtt
181 agtagaaaag attggaatga gatgttgcag aatgtgacta caaaactaaa agaaatcttt
241 gacaacagaa ccataacatt taactcagct gcaggaggag atctagaaat tacaacacat
301 agttttaatt gtagaggaga atttttctat tgtaatacat caggactgtt taataatagt
361 aagaccaact ccactatcac actcccatgt aggataaaac aaattataag aatgtggcag
421 agagtggggc aagcaatgta tgcccctccc atcgcaggaa acattacatg tatttcaaac
481 attacaggac tactattaac aagagatggt gggaacaata ataacagcac aaatgagacc
541 ttcagacctg gaggaggaga tatgagggac aattggagaa gtgaattata taagtataaa
601 gtagtaagaa ttaaaccact aggagtagca cccaccaggg caaggagaag agtggtgggg
661 ggagaaaaaa gagcagtt
//
last modified: Tue May 31 10:56 2022