HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    HIV1U08360		     678 bp    DNA     linear	VRL 26-AUG-1996
DEFINITION  HIV-1 RU107A from Russia, gp120 V3-V5 region (env) gene, partial
	    cds
ACCESSION   U08360
VERSION     U08360.1 GI:533443
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 678)
            Show all sequences for reference 1
  AUTHORS   Bobkov,A., Cheingsong-Popov,R., Garaev,M., Rzhaninova,A.,
	    Kaleebu,P., Beddows,S., Bachmann,M.H., Mullins,J.I., Louwagie,J.,
	    Janssens,W., van der Groen,G., McCutchan,F. and Weber,J.
  TITLE     Identification of an env G subtype and heterogeneity of HIV-1
	    strains in the Russian Federation and Belarus
  JOURNAL   AIDS 8 (12), 1649-1655 (1994)
  PUBMED    7888112
REFERENCE   2 (sites)
            Show all sequences for reference 2
  AUTHORS   Bobkov,A., Cheingsong-Popov,R., Garaev,M. and Weber,J.
  TITLE     Glycoprotein 120 polymorphism in an HIV type 1 epidemic originating
	    from a point source: nucleotide sequence analysis of variants with
	    conserved V3 loop sequences
  JOURNAL   AIDS Res. Hum. Retroviruses 12 (3), 251-253 (1996)
  PUBMED    8835204
REFERENCE   3 (bases 1 to 678)
            Show all sequences for reference 3
  AUTHORS   Bobkov,A.F.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-1994) Aleksei F. Bobkov, The DI Ivanovsky
	    Institute of Virology, Department of Molecular Virology, 16
	    Gamaleya Street, Moscow, 123098, Russia
COMMENT     One of the earliest detected cases of HIV-1 Group M in the former
	    French colonies came from the town of Brazzaville, Congo across the
	    river from Kinshasa, DRC, where a Soviet man received an
	    HIV-1-infected blood transfusion in 1981. The HIV-infected child of
	    this man was subsequently admitted to a hospital in Elista,
	    Georgia, where the reuse of unsterilised needles led to one of the
	    world’s worst nosocomial outbreaks of HIV infection, with another
	    57 infants infected by the end of the eighties [M. Smallman-Raynor,
	    A. Cliff and P. Haggett, Atlas of AIDS (London: Blackwell, 1992),
	    pages 332-334.]
FEATURES             Location/Qualifiers
     source	     1..678
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /strain="RU107A"
		     /db_xref="taxon:11676"
     gene	     1..678
		     /gene="env"
     CDS	     <1..>678
		     /gene="env"
		     /note="V3-V5 region"
		     /codon_start="1"
		     /transl_table="1"
		     /product="gp120"
		     /protein_id="AAC55344.1"
		     /db_xref="GI:533444"
		     /translation="RSENFTDNAKVIIVQLNKSVEIICTRPNNNTRKSIHFGPGQALY
		     ATGEIIGDIRQAHCNVSRKDWNEMLQNVTTKLKEIFDNRTITFNSAAGGDLEITTHSF
		     NCRGEFFYCNTSGLFNNSKTNSTITLPCRIKQIIRMWQRVGQAMYAPPIAGNITCISN
		     ITGLLLTRDGGNNNNSTNETFRPGGGDMRDNWRSELYKYKVVRIKPLGVAPTRARRRV
		     VGGEKRAV"
BASE COUNT	275 a	 106 c	  144 g    153 t
ORIGIN
       1 agatctgaaa acttcacaga caatgccaaa gtcataatag tgcagcttaa taaatctgta 
      61 gaaattatat gtactagacc caataacaat acaagaaaaa gtatacattt cggaccagga 
     121 caagcgctct atgcaacagg tgaaataata ggagatataa gacaagcaca ttgtaatgtt 
     181 agtagaaaag attggaatga gatgttgcag aatgtgacta caaaactaaa agaaatcttt 
     241 gacaacagaa ccataacatt taactcagct gcaggaggag atctagaaat tacaacacat 
     301 agttttaatt gtagaggaga atttttctat tgtaatacat caggactgtt taataatagt 
     361 aagaccaact ccactatcac actcccatgt aggataaaac aaattataag aatgtggcag 
     421 agagtggggc aagcaatgta tgcccctccc atcgcaggaa acattacatg tatttcaaac 
     481 attacaggac tactattaac aagagatggt gggaacaata ataacagcac aaatgagacc 
     541 ttcagacctg gaggaggaga tatgagggac aattggagaa gtgaattata taagtataaa 
     601 gtagtaagaa ttaaaccact aggagtagca cccaccaggg caaggagaag agtggtgggg 
     661 ggagaaaaaa gagcagtt
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health