HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    HIVFLQ710		     304 bp    RNA     linear	VRL 09-JUL-1992
DEFINITION  Human immunodeficiency virus type 1, viral sample LC03.DA10, V3
	    region
ACCESSION   M90928
VERSION     M90928.1 GI:327279
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 304)
            Show all sequences for reference 1
  AUTHORS   Ou,C.-Y., Ciesielski,C.A., Myers,G., Bandea,C.I., Luo,C.C.,
	    Korber,B.T.M., Mullins,J.I., Schochetman,G., Berkelman,R.L.,
	    Economou,A.N., Witte,J.J., Furman,L.J., Satten,G.A., MacInnes,K.A.,
	    Curran,J.W. and Jaffe,H.W.
  TITLE     Molecular epidemiology of HIV transmission in a dental practice
  JOURNAL   Science 256 (5060), 1165-1171 (1992)
  PUBMED    1589796
COMMENT     Kindly submitted in computer readable form by the CDC (Centers for
	    Disease Control), Atlanta, GA. The sequence in this entry is one of
	    6 clone sequences over the V3 region obtained by the CDC from this
	    Florida control sample. Please note that for this set of sequences,
	    clone numbers from the V3 region do not correspond with similar
	    numbers from the V4C3V5 region. There are 236 sequences in this
	    sample group; all are env V3 sequences or env V4C3V5. They include:
	    dentist(13), dentist's patients pA(28), pB(34), pC(8), pD(14),
	    pE(11), pF(13), pG(9), pH(6) and local controls (LC), LC01(28),
	    LC02(11), LC03(19), LC04(6) and other LC up to LC42 (1-2 sequences
	    per person).
FEATURES             Location/Qualifiers
     source	     1..304
		     /organism="Human immunodeficiency virus 1"
		     /mol_type="genomic RNA"
		     /db_xref="taxon:11676"
     CDS	     <1..>304
		     /note="env polyprotein"
		     /codon_start="1"
		     /transl_table="1"
		     /protein_id="AAA44605.1"
		     /db_xref="GI:554912"
		     /translation="LAEEEIVIRSANFTDNTKIIIVQLNESVEINCTRPSNNTSKSIH
		     IGPGSAFYATGRIIGDIRQAHCNISKAKWNDTLKRVVIKLREHFGNKPIVFDHPSGG"
BASE COUNT	129 a	  45 c	   60 g     70 t
ORIGIN
       1 ctagcagaag aagagatagt aattagatct gccaatttca cggacaatac taaaatcata 
      61 atagtacagc tgaatgaatc tgtagaaatt aattgtacaa gacccagcaa caatacaagt 
     121 aagagtatac atataggacc aggtagcgca ttttatgcaa caggaagaat aataggagat 
     181 ataagacaag cacattgtaa cattagtaaa gcaaaatgga atgacacttt aaaacgggta 
     241 gtaataaaat taagagaaca ttttgggaat aaaccaatag tctttgatca cccctcagga 
     301 gggg
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health