View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIVFLQ618 320 bp RNA linear VRL 09-JUL-1992
DEFINITION Human immunodeficiency virus type 1, viral sample LC02.DA18, V3
region
ACCESSION M90921
VERSION M90921.1 GI:327259
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 320)
Show all sequences for reference 1
AUTHORS Ou,C.-Y., Ciesielski,C.A., Myers,G., Bandea,C.I., Luo,C.C.,
Korber,B.T.M., Mullins,J.I., Schochetman,G., Berkelman,R.L.,
Economou,A.N., Witte,J.J., Furman,L.J., Satten,G.A., MacInnes,K.A.,
Curran,J.W. and Jaffe,H.W.
TITLE Molecular epidemiology of HIV transmission in a dental practice
JOURNAL Science 256 (5060), 1165-1171 (1992)
PUBMED 1589796
COMMENT Kindly submitted in computer readable form by the CDC (Centers for
Disease Control), Atlanta, GA. The sequence in this entry is one of
6 clone sequences over the V3 region obtained by the CDC from this
Florida control sample. Please note that for this set of sequences,
clone numbers from the V3 region do not correspond with similar
numbers from the V4C3V5 region. There are 236 sequences in this
sample group; all are env V3 sequences or env V4C3V5. They include:
dentist(13), dentist's patients pA(28), pB(34), pC(8), pD(14),
pE(11), pF(13), pG(9), pH(6) and local controls (LC), LC01(28),
LC02(11), LC03(19), LC04(6) and other LC up to LC42 (1-2 sequences
per person).
FEATURES Location/Qualifiers
source 1..320
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/db_xref="taxon:11676"
CDS <1..>320
/note="env polyprotein"
/codon_start="1"
/transl_table="1"
/protein_id="AAA44600.1"
/db_xref="GI:554910"
/translation="LAEEEIVIRSANFTDNTKIIIVQLNESVEINCTRPSNNTRKSIP
IGPGRAFYATGDVIGDIRQAHCNISGAKWNNTLKRIVIKLKEQFPNKTIVFNQSSGGD
PEIV"
BASE COUNT 141 a 48 c 57 g 74 t
ORIGIN
1 ctagcagaag aagagatagt aattagatct gccaatttca cagacaatac taaaatcata
61 atagtacagc tgaatgagtc tgtagaaatt aattgtacaa gacccagcaa caatacaaga
121 aaaagtatac ctataggacc aggcagagca ttttatgcaa caggagatgt aataggagat
181 ataagacaag cacattgtaa cattagtgga gcaaaatgga ataacacttt aaaacggata
241 gttataaaat taaaagaaca atttccaaat aaaacaatag tctttaatca atcctcagga
301 ggggacccag aaattgtaat
//
last modified: Tue May 31 10:56 2022