HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    HIVFLPB209		     342 bp    RNA     linear	VRL 09-JUL-1992
DEFINITION  Human immunodeficiency virus type 1, viral sample FLPB29, V3 region
ACCESSION   M90871
VERSION     M90871.1 GI:326934
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 342)
            Show all sequences for reference 1
  AUTHORS   Ou,C.-Y., Ciesielski,C.A., Myers,G., Bandea,C.I., Luo,C.C.,
	    Korber,B.T.M., Mullins,J.I., Schochetman,G., Berkelman,R.L.,
	    Economou,A.N., Witte,J.J., Furman,L.J., Satten,G.A., MacInnes,K.A.,
	    Curran,J.W. and Jaffe,H.W.
  TITLE     Molecular epidemiology of HIV transmission in a dental practice
  JOURNAL   Science 256 (5060), 1165-1171 (1992)
  PUBMED    1589796
COMMENT     Kindly submitted in computer readable form by the CDC (Centers for
	    Disease Control), Atlanta, GA. The sequence in this entry is one of
	    13 clone sequences over the V3 region obtained by the CDC from
	    patient \'B\' of a Florida dentist. Please note that for this set
	    of sequences, clone numbers from the V3 region do not correspond
	    with similar numbers from the V4C3V5 region. There are 236
	    sequences in this sample group; all are env V3 sequences or env
	    V4C3V5. They include: dentist(13), dentist's patients pA(28),
	    pB(34), pC(8), pD(14), pE(11), pF(13), pG(9), pH(6) and 98 local
	    controls (LC), LC01(28), LC02(11), LC03(19), LC04(6) and other LC
	    up to LC42 (1-2 sequences per person).
FEATURES             Location/Qualifiers
     source	     1..342
		     /organism="Human immunodeficiency virus 1"
		     /mol_type="genomic RNA"
		     /db_xref="taxon:11676"
     CDS	     <1..>342
		     /note="env polyprotein"
		     /codon_start="1"
		     /transl_table="1"
		     /protein_id="AAA44473.1"
		     /db_xref="GI:326935"
		     /translation="LAEEEVVIRSANFTDNAKIIIVQLNASVEINCTRPNNNTRKGIH
		     IGPGRAFYATGEIIGDIRQAHCNISRVKWNNTLEQVKTKLKEQFGNKTIIFNHSSGGD
		     PEIVMHSFNCGG"
BASE COUNT	148 a	  48 c	   68 g     78 t
ORIGIN
       1 ctagcagaag aagaagtagt aattagatct gccaatttca cagacaatgc taaaatcata 
      61 atagtacagc tgaatgcatc tgtagaaatt aattgtacaa gacccaacaa caatacaaga 
     121 aaaggtatac atataggacc agggagggca ttttatgcaa caggagaaat aataggagat 
     181 ataagacaag cacattgtaa cattagtaga gtaaaatgga ataatacctt agaacaggta 
     241 aagacaaaat taaaagaaca atttgggaat aaaacaataa tctttaatca ctcctcagga 
     301 ggggacccag aaattgtaat gcacagtttt aattgtggag gg
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health