View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIVFLPB209 342 bp RNA linear VRL 09-JUL-1992
DEFINITION Human immunodeficiency virus type 1, viral sample FLPB29, V3 region
ACCESSION M90871
VERSION M90871.1 GI:326934
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 342)
Show all sequences for reference 1
AUTHORS Ou,C.-Y., Ciesielski,C.A., Myers,G., Bandea,C.I., Luo,C.C.,
Korber,B.T.M., Mullins,J.I., Schochetman,G., Berkelman,R.L.,
Economou,A.N., Witte,J.J., Furman,L.J., Satten,G.A., MacInnes,K.A.,
Curran,J.W. and Jaffe,H.W.
TITLE Molecular epidemiology of HIV transmission in a dental practice
JOURNAL Science 256 (5060), 1165-1171 (1992)
PUBMED 1589796
COMMENT Kindly submitted in computer readable form by the CDC (Centers for
Disease Control), Atlanta, GA. The sequence in this entry is one of
13 clone sequences over the V3 region obtained by the CDC from
patient \'B\' of a Florida dentist. Please note that for this set
of sequences, clone numbers from the V3 region do not correspond
with similar numbers from the V4C3V5 region. There are 236
sequences in this sample group; all are env V3 sequences or env
V4C3V5. They include: dentist(13), dentist's patients pA(28),
pB(34), pC(8), pD(14), pE(11), pF(13), pG(9), pH(6) and 98 local
controls (LC), LC01(28), LC02(11), LC03(19), LC04(6) and other LC
up to LC42 (1-2 sequences per person).
FEATURES Location/Qualifiers
source 1..342
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/db_xref="taxon:11676"
CDS <1..>342
/note="env polyprotein"
/codon_start="1"
/transl_table="1"
/protein_id="AAA44473.1"
/db_xref="GI:326935"
/translation="LAEEEVVIRSANFTDNAKIIIVQLNASVEINCTRPNNNTRKGIH
IGPGRAFYATGEIIGDIRQAHCNISRVKWNNTLEQVKTKLKEQFGNKTIIFNHSSGGD
PEIVMHSFNCGG"
BASE COUNT 148 a 48 c 68 g 78 t
ORIGIN
1 ctagcagaag aagaagtagt aattagatct gccaatttca cagacaatgc taaaatcata
61 atagtacagc tgaatgcatc tgtagaaatt aattgtacaa gacccaacaa caatacaaga
121 aaaggtatac atataggacc agggagggca ttttatgcaa caggagaaat aataggagat
181 ataagacaag cacattgtaa cattagtaga gtaaaatgga ataatacctt agaacaggta
241 aagacaaaat taaaagaaca atttgggaat aaaacaataa tctttaatca ctcctcagga
301 ggggacccag aaattgtaat gcacagtttt aattgtggag gg
//
last modified: Tue May 31 10:56 2022