View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIVTOT219 159 bp RNA linear VRL 01-OCT-1996
DEFINITION Human immunodeficiency virus type 1 (NLR09) env gene, V3 region,
partial cds
ACCESSION M76871
VERSION M76871.1 GI:328846
KEYWORDS envelope-associated protein; hypervariable region; neutralizing
domain; surface glycoprotein.
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 159)
Show all sequences for reference 1
AUTHORS Wolinsky,S.M., Wike,C.M., Korber,B.T., Hutto,C., Parks,W.P.,
Rosenblum,L.L., Kunstman,K.J., Furtado,M.R. and Munoz,J.L.
TITLE Selective transmission of human immunodeficiency virus type-1
variants from mothers to infants
JOURNAL Science 255 (5048), 1134-1137 (1992)
PUBMED 1546316
COMMENT An alignment of all 21 sequences with the sequences from the paired
mother (HIVMOM11) is shown following entry in the March
update of Human Retroviruses and AIDS, 1992.
FEATURES Location/Qualifiers
source 1..159
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/db_xref="taxon:11676"
/tissue_type="peripheral blood"
gene 1..159
/gene="env"
CDS <1..>159
/gene="env"
/note="V3 region"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAB09327.1"
/db_xref="GI:1574839"
/translation="ENFTNNAKIIIVQLNTSVDITCTRPNNNTRKSIHIAPGSAWYAT
GDIIGDIRQ"
BASE COUNT 74 a 29 c 26 g 30 t
ORIGIN
1 gaaaatttca cgaacaatgc taaaatcata atagtacaac taaacacatc tgtagatatt
61 acctgtacaa gacccaacaa caacacaaga aaaagtatac atatagcacc agggagcgca
121 tggtatgcaa caggagatat aataggagat ataagacaa
//
last modified: Tue May 31 10:56 2022