View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIVTOT1112 156 bp RNA linear VRL 30-SEP-1996
DEFINITION Human immunodeficiency virus type 1 (86X) env gene, V3 region,
partial cds
ACCESSION M76853
VERSION M76853.1 GI:328810
KEYWORDS envelope-associated protein; hypervariable region; neutralizing
domain; surface glycoprotein.
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 156)
Show all sequences for reference 1
AUTHORS Wolinsky,S.M., Wike,C.M., Korber,B.T., Hutto,C., Parks,W.P.,
Rosenblum,L.L., Kunstman,K.J., Furtado,M.R. and Munoz,J.L.
TITLE Selective transmission of human immunodeficiency virus type-1
variants from mothers to infants
JOURNAL Science 255 (5048), 1134-1137 (1992)
PUBMED 1546316
COMMENT An alignment of all 21 sequences with the sequences from the paired
mother (HIVMOM11) is shown following entry in the March
update of Human Retroviruses and AIDS, 1992.
FEATURES Location/Qualifiers
source 1..156
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/db_xref="taxon:11676"
/tissue_type="peripheral blood"
gene 1..156
/gene="env"
CDS <1..>156
/gene="env"
/note="V3 region"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAB09235.1"
/db_xref="GI:1572898"
/translation="ENLTNNAKTIIVQLQTPVNITCTRPNNNTRKSIHMGPGRAFYAT
NIVGDIRQ"
BASE COUNT 70 a 30 c 27 g 29 t
ORIGIN
1 gaaaatctca cgaacaatgc taaaaccata atagtacagc tgcagacacc tgtaaacatt
61 acttgtacaa gacccaacaa caatacaaga aaaagtatac atatggggcc agggagagca
121 ttttatgcaa caaacatagt aggagatata agacaa
//
last modified: Tue May 31 10:56 2022