View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIV140692X 275 bp DNA linear VRL 26-JUL-1993
DEFINITION Human immunodeficiency virus type 1 (4069-2) proviral envelope
glycoprotein (env) gene, V3 region
ACCESSION L11504
VERSION L11504.1 GI:305539
KEYWORDS PCR primer; env gene; envelope glycoprotein; variable region.
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 275)
Show all sequences for reference 1
AUTHORS Murphy,E., Korber,B.T., Georges-Courbot,M.-C., You,B., Pinter,A.,
Cook,D., Kieny,M.-P., Georges,A., Mathiot,C., Barre-Sinoussi,F. and
Girard,M.
TITLE Diversity of V3 region sequences of human immunodeficiency viruses
type 1 from the central African Republic
JOURNAL AIDS Res. Hum. Retroviruses 9 (10), 997-1006 (1993)
PUBMED 8280481
COMMENT Only amino acid sequence reported.
FEATURES Location/Qualifiers
source 1..275
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="unassigned DNA"
/db_xref="taxon:11676"
gene 1..275
/gene="env"
CDS <1..>275
/gene="env"
/note="V3 region"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAC37835.1"
/db_xref="GI:305540"
/translation="GIIIRSENLADNAKTIIVHLNESVEINCTRPFKKTRISARIGPG
RVFHKTGAILGDIRKAFCEINKTRWNDTLNKVTEKLKEHFKKTILFQP"
BASE COUNT 121 a 45 c 49 g 60 t
ORIGIN
1 gggataataa tcagatctga aaatctcgca gacaatgcca aaaccataat agtgcacctt
61 aatgaatctg tagaaatcaa ttgtaccaga cccttcaaaa agacaaggat aagtgcaagg
121 ataggaccag gacgagtatt ccataaaaca ggagccatac taggagatat aagaaaagca
181 ttttgtgaga ttaataaaac aagatggaat gacactttaa ataaggtaac tgaaaaatta
241 aaagagcact ttaaaaagac aatactcttt caacc
//
last modified: Tue May 31 10:56 2022