View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIVS1652 105 bp RNA linear VRL 21-NOV-1994
DEFINITION Human immunodeficiency virus type 1 (patient Ams-165) envelope
glycoprotein V3 loop (env) gene, partial cds
ACCESSION L06697
VERSION L06697.1 GI:328595
KEYWORDS V-region; V3 loop; env gene; envelope protein; glycoprotein 120.
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 105)
Show all sequences for reference 1
AUTHORS Fouchier,R.A., Groenink,M., Kootstra,N.A., Tersmette,M.,
Huisman,H.G., Miedema,F. and Schuitemaker,H.
TITLE Phenotype-associated sequence variation in the third variable
domain of the human immunodeficiency virus type 1 gp120 molecule
JOURNAL J. Virol. 66 (5), 3183-3187 (1992)
PUBMED 1560543
FEATURES Location/Qualifiers
source 1..105
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/db_xref="taxon:11676"
gene 1..105
/gene="env"
CDS <1..>105
/gene="env"
/codon_start="1"
/transl_table="1"
/protein_id="AAA53330.1"
/db_xref="GI:328596"
/translation="CTRLSNNTRRGVHIGPGRAFYTTGAVIGDIRQAHC"
BASE COUNT 43 a 17 c 25 g 20 t
ORIGIN
1 tgtacaagac tcagcaacaa tacaagaaga ggtgtacata taggaccagg gagagcattt
61 tatacaacag gagctgtaat aggagacata agacaagcac attgt
//
last modified: Tue May 31 10:56 2022