HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    JQ957660		     554 bp    RNA     linear	VRL 14-JUL-2012
DEFINITION  HIV-1 isolate CH58d154.CA11 from USA envelope glycoprotein (env)
	    gene, partial cds
ACCESSION   JQ957660
VERSION     JQ957660.1 GI:389587108
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 554)
            Show all sequences for reference 1
  AUTHORS   Bar,K.J., Tsao,C.Y., Iyer,S.S., Decker,J.M., Yang,Y.,
	    Bonsignori,M., Chen,X., Hwang,K.K., Montefiori,D.C., Liao,H.X.,
	    Hraber,P., Fischer,W., Li,H., Wang,S., Sterrett,S., Keele,B.F.,
	    Ganusov,V.V., Perelson,A.S., Korber,B.T., Georgiev,I.,
	    McLellan,J.S., Pavlicek,J.W., Gao,F., Haynes,B.F., Hahn,B.H.,
	    Kwong,P.D. and Shaw,G.M.
  TITLE     Early Low-Titer Neutralizing Antibodies Impede HIV-1 Replication
	    and Select for Virus Escape
  JOURNAL   PLoS Pathog. 8 (5), E1002721 (2012)
  PUBMED    22693447
REFERENCE   2 (bases 1 to 554)
            Show all sequences for reference 2
  AUTHORS   Bar,K.J., Tsao,C.-y., Iyer,S.S., Decker,J.M., Yang,Y.,
	    Bonsignori,M., Chen,X., Hwang,K.-K., Montefiori,D.C., Liao,H.-X.,
	    Hraber,P., Fischer,W., Li,H., Wang,S., Sterrett,S., Keele,B.F.,
	    Ganusov,V.V., Perelson,A.S., Korber,B.T., Georgiev,I.,
	    McLellan,J.S., Pavlicek,J.W., Gao,F., Haynes,B.F., Hahn,B.H.,
	    Kwong,P.D. and Shaw,G.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-APR-2012) Department of Medicine, University of
	    Pennsylvania, 3610 Hamilton Walk, Philadelphia, PA 19104, USA
COMMENT     Annotation information was provided by the author. Some of the
	    information does not have GenBank feature identifiers and is being
	    provided in the comment section. Information in this section is
	    searchable in HIV-1 Database at Los Alamos (hiv.lanl.gov).;
	    ##HIVDataBaseData-START## patient code 700010058 patient sex M
	    Sample city North Carolina HLA type A*0101 A*2301 B*1402 B*5701
	    Cw*0701 Cw*0802 Risk factor sex with male ##HIVDataBaseData-END##
FEATURES             Location/Qualifiers
     source	     1..554
		     /organism="Human immunodeficiency virus 1"
		     /mol_type="genomic RNA"
		     /isolate="CH58d154.CA11"
		     /host="Homo sapiens"
		     /db_xref="taxon:11676"
		     /country="USA"
		     /collection_date="07-Jan-2007"
		     /note="subtype: B"
     gene	     <1..>554
		     /gene="env"
     CDS	     <1..>554
		     /gene="env"
		     /codon_start="1"
		     /transl_table="1"
		     /product="envelope glycoprotein"
		     /protein_id="AFK88141.1"
		     /db_xref="GI:389587109"
		     /translation="SEGKEMKNCSFNIPTSMQDKTKKEYALFYKLDIVKIDDSNNSTN
		     NSTYRLISCNTSVVTQACPKVSFQPIPIHYCAPAGFAILKCNNKAFNGTGQCTNVSTV
		     QCTHGIRPVVSTQLLLNGSLAEKDIVLRSANFTNNAKTIIVQLNESVIINCTRPNNNT
		     RKSITIGPGRAFYATGDIIGDIRQA"
BASE COUNT	214 a	  97 c	  105 g    138 t
ORIGIN
       1 agcgagggaa aggaaatgaa gaactgttct ttcaacatcc ccacaagcat gcaggataag 
      61 acgaagaaag aatatgcact cttttataaa cttgatatag taaaaataga tgatagtaat 
     121 aatagtacca ataatagtac ctataggttg ataagttgta acacctcagt cgttacacag 
     181 gcctgtccaa aggtatcttt tcagccaatt cctatacatt attgtgcccc ggctggtttt 
     241 gcgattctaa agtgtaataa taaggctttc aatggaacag gacaatgtac aaatgtcagc 
     301 acagtgcaat gcacacatgg aattaggcca gtagtatcaa ctcaactgct gttaaatggc 
     361 agtctagcag aaaaagatat agtacttagg tctgccaatt tcacaaacaa tgctaaaacc 
     421 ataatagtac agctgaatga atctgtaata attaattgta caagacccaa caacaataca 
     481 agaaaaagta taactatagg accagggaga gcattttatg caacaggaga tataatagga 
     541 gacataagac aagc
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health