HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    JQ866059		     435 bp    RNA     linear	VRL 12-SEP-2012
DEFINITION  Simian immunodeficiency virus isolate MU409 envelope glycoprotein
	    (env) gene, partial cds
ACCESSION   JQ866059
VERSION     JQ866059.1 GI:392872227
KEYWORDS    .
SOURCE	    Simian immunodeficiency virus (SIV)
  ORGANISM  Simian immunodeficiency virus Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 435)
            Show all sequences for reference 1
  AUTHORS   Li,Y., Ndjango,J.B., Learn,G.H., Ramirez,M.A., Keele,B.F.,
	    Bibollet-Ruche,F., Liu,W., Easlick,J.L., Decker,J.M.,
	    Rudicell,R.S., Inogwabini,B.I., Ahuka-Mundeke,S., Leendertz,F.H.,
	    Reynolds,V., Muller,M.N., Chancellor,R.L., Rundus,A.S., Simmons,N.,
	    Worobey,M., Shaw,G.M., Peeters,M., Sharp,P.M. and Hahn,B.H.
  TITLE     Eastern chimpanzees, but not bonobos, represent a simian
	    immunodeficiency virus reservoir
  JOURNAL   J. Virol. 86 (19), 10776-10791 (2012)
  PUBMED    22837215
REFERENCE   2 (bases 1 to 435)
            Show all sequences for reference 2
  AUTHORS   Li,Y., Ndjango,J.-B., Learn,G.H., Keele,B.F., Bibollet-Ruche,F.,
	    Easlick,J., Decker,J.M., Rudicell,R.S., Inogwabini,B.-I.,
	    Ahuka-Mundeke,S., Leendertz,F.H., Reynolds,V., Muller,M.N.,
	    Chancellor,R.L., Rundus,A.S., Simmonds,N., Worobey,M., Shaw,G.M.,
	    Peeters,M., Sharp,P.M. and Hahn,B.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2012) Dept. of Medicine, Perelman School of
	    Medicine, University of Pennsylvania, Johnson Pavilion 423, 3610
	    Hamilton Walk, Philadelphia, PA 19104, USA
COMMENT     ##Assembly-Data-START## Assembly Method Sequencher v. 4 Sequencing
	    Technology Sanger dideoxy sequencing ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source	     1..435
		     /organism="Simian immunodeficiency virus"
		     /mol_type="genomic RNA"
		     /isolate="MU409"
		     /isolation_source="feces"
		     /host="Pan troglodytes schweinfurthii"
		     /db_xref="taxon:11723"
		     /country="Democratic Republic of the Congo"
		     /collection_date="27-Dec-2005"
     gene	     <1..>435
		     /gene="env"
     CDS	     <1..>435
		     /gene="env"
		     /codon_start="1"
		     /transl_table="1"
		     /product="envelope glycoprotein"
		     /protein_id="AFM85386.1"
		     /db_xref="GI:392872228"
		     /translation="TAQSRSLLHGIVQQQANLLQAIETQQHLLQLSIWGIKQLQARML
		     AIEKYLRDQQLLSLWGCADKLVCHTTVEWNSSWVINTGQGCPANDTQDYDCIWKNLTW
		     QEWDRMVQNSTSLIYKQLENAQIQQEQNKKQLLELDKWSSLWS"
BASE COUNT	150 a	  89 c	   94 g    102 t
ORIGIN
       1 acggcacagt ccaggagctt gctccatgga attgtacagc agcaagccaa cttgctgcaa 
      61 gccatagaaa ctcaacaaca tttgttgcag ctttctatct ggggtataaa acaactccag 
     121 gcgagaatgc ttgcaataga gaagtaccta agagatcagc aactcttaag tctttgggga 
     181 tgcgctgaca aactggtctg tcataccact gtggaatgga acagctcttg ggtaataaac 
     241 actgggcaag gctgtcctgc caacgatact caggattatg attgtatttg gaaaaacctc 
     301 acctggcaag aatgggacag aatggttcaa aactccacaa gtcttatata taagcaatta 
     361 gaaaatgcac aaatacagca agaacagaat aagaaacaac tattagaatt agataaatgg 
     421 agctccttat ggtct
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health