HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    JQ479405		     249 bp    DNA     linear	VRL 02-APR-2012
DEFINITION  HIV-1 isolate env_Q_pre_18 from USA envelope glycoprotein (env)
	    gene, partial cds
ACCESSION   JQ479405
VERSION     JQ479405.1 GI:381343208
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 249)
            Show all sequences for reference 1
  AUTHORS   Pillai,S.K., Abdel-Mohsen,M., Guatelli,J., Skasko,M., Monto,A.,
	    Fujimoto,K., Yukl,S., Greene,W.C., Kovari,H., Rauch,A., Fellay,J.,
	    Battegay,M., Hirschel,B., Witteck,A., Bernasconi,E.,
	    Ledergerber,B., Gunthard,H.F. and Wong,J.K.
  CONSRTM   the Swiss HIV Cohort Study
  TITLE     Role of retroviral restriction factors in the
	    interferon-alpha-mediated suppression of HIV-1 in vivo
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 109 (8), 3035-3040 (2012)
  PUBMED    22315404
REFERENCE   2 (bases 1 to 249)
            Show all sequences for reference 2
  AUTHORS   Pillai,S.K., Abdel-Mohsen,M., Guatelli,J., Skasko,M., Monto,A.,
	    Fujimoto,K., Yukl,S., Greene,W.C., Kovari,H., Rauch,A., Fellay,J.,
	    Battegay,M., Hirschel,B., Witteck,A., Bernasconi,E.,
	    Ledergerber,B., Gunthard,H.F. and Wong,J.K.
  CONSRTM   the Swiss HIV Cohort Study
  TITLE     Direct Submission
  JOURNAL   Submitted (24-JAN-2012) Medicine/VA Medical Center, University of
	    California, San Francisco, 4150 Clement St. (111W), San Francisco,
	    CA 94121, USA
COMMENT     ##Assembly-Data-START## Sequencing Technology Sanger dideoxy
	    sequencing ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source	     1..249
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /isolate="env_Q_pre_18"
		     /isolation_source="PBMC"
		     /host="Homo sapiens"
		     /db_xref="taxon:11676"
		     /country="USA"
		     /collection_date="10-Oct-2010"
     gene	     <1..249
		     /gene="env"
     CDS	     <1..249
		     /gene="env"
		     /codon_start="1"
		     /transl_table="1"
		     /product="envelope glycoprotein"
		     /protein_id="AFG23645.1"
		     /db_xref="GI:381343209"
		     /translation="LLIVARIVELLGRRGWDILKYWWNLLQYWSQELKNSAVSLLNAT
		     AIAVAEGTDRVIEIVRRAFRAILHIPTRIRQGAERALL"
BASE COUNT	 76 a	  43 c	   69 g     61 t
ORIGIN
       1 ctcttgattg tagcgaggat tgtggaactt ctgggacgca gggggtggga tatcctcaaa 
      61 tattggtgga atctcctaca gtattggagt caggaactaa agaatagtgc tgttagcttg 
     121 ctcaacgcca cagccatagc agtagctgaa gggacagata gggttataga aatagtaaga 
     181 agagctttta gagctattct ccacatacct acaagaataa gacagggcgc ggaaagggct 
     241 ttgctataa
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health