HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    JN820400		     297 bp    RNA     linear	VRL 28-NOV-2011
DEFINITION  HIV-1 isolate Primer ID AAGAATGG_T1_5 from USA protease (pol) gene,
	    partial cds
ACCESSION   JN820400
VERSION     JN820400.1 GI:358013697
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 297)
            Show all sequences for reference 1
  AUTHORS   Jabara,C.B., Jones,C.D., Roach,J., Anderson,J.A. and Swanstrom,R.
  TITLE     Accurate sampling and deep sequencing of the HIV-1 protease gene
	    using a Primer ID.
  JOURNAL   Proc. Natl. Acad. Sci. U. S. A.. 108(50); 20166-71 (2011)
  PUBMED    22135472
REFERENCE   2 (bases 1 to 297)
            Show all sequences for reference 2
  AUTHORS   Jabara,C.B., Jones,C.D., Roach,J., Anderson,J.A. and Swanstrom,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-OCT-2011) Department of Biology, Lineberger
	    Comprehensive Cancer Center, UNC Center for AIDS Research,
	    University of North Carolina at Chapel Hill, CB 7295, Chapel Hill,
	    NC 27599-7295, USA
FEATURES             Location/Qualifiers
     source	     1..297
		     /organism="Human immunodeficiency virus 1"
		     /mol_type="genomic RNA"
		     /isolate="Primer ID AAGAATGG_T1_5"
		     /isolation_source="blood plasma from ABT-538 patient 1024
		     pre-ritonavir monotherapy"
		     /host="Homo sapiens"
		     /db_xref="taxon:11676"
		     /country="USA"
		     /collection_date="05-Jul-1995"
		     /note="sequenced by GS FLX platform with XLR70 Titanium
		     sequencing chemistry; represents the consensus of 5
		     individual reads; assembled by a custom bioinformatics
		     suite subtype: B; group: M"
     gene	     <1..>297
		     /gene="pol"
     CDS	     <1..>297
		     /gene="pol"
		     /codon_start="1"
		     /transl_table="1"
		     /product="protease"
		     /protein_id="AET99368.1"
		     /db_xref="GI:358013698"
		     /translation="PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEMNLPGKWKP
		     KMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF"
BASE COUNT	114 a	  46 c	   62 g     75 t
ORIGIN
       1 cctcaaatca ctctttggca acgacccctc gtcacaataa agataggggg gcaaataaag 
      61 gaagctctat tagatacagg agcagatgat acagtattag aagaaatgaa tttgccagga 
     121 aaatggaaac caaaaatgat aggaggaatt ggaggtttta tcaaagtaag acagtatgat 
     181 caaatactca tagaaatctg tggacataaa gctataggta cagtattagt aggacctaca 
     241 cctgtcaaca taattggaag aaatctattg actcagattg gttgcacttt aaatttt
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health