View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS JN638148 1164 bp DNA linear VRL 26-SEP-2011
DEFINITION HIV-1 isolate A252 from South Africa pol protein (pol) and gag
protein (gag) genes, partial cds
ACCESSION JN638148
VERSION JN638148.1 GI:346420663
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 1164)
Show all sequences for reference 1
AUTHORS van Zyl,G., Van der Merwe,L., Claassen,M., Zeier,M. and Preiser,W.
TITLE Antiretroviral resistance patterns and factors associated with
resistance in adult patients failing NNRTI-based regimens in the
western cape, South Africa
JOURNAL J. Med. Virol. 83 (10), 1764-1769 (2011)
PUBMED 21837793
REFERENCE 2 (bases 1 to 1164)
Show all sequences for reference 2
AUTHORS van Zyl,G., Van der Merwe,L., Claassen,M., Zeier,M. and Preiser,W.
TITLE Direct Submission
JOURNAL Submitted (29-AUG-2011) Division of Medical Virology, Stellenbosch
University, Francie van Zijl Drive, Parow 7500, South Africa
COMMENT Annotation information was provided by the author. Some of the
information does not have GenBank feature identifiers and is being
provided in the comment section. Information in this section is
searchable in HIV Database at Los Alamos (www.hiv.lanl.gov).;
##HIVDataBaseData-START## Sequence name A252 Patient sex Female
Patient age 29 Patient comment AZT 3TC EFV CD4 count 210 Viral Load
2300 ##HIVDataBaseData-END##
FEATURES Location/Qualifiers
source 1..1164
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="A252"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="South Africa"
/collection_date="24-Feb-2009"
gene <1..>1164
/gene="pol"
CDS <1..>1164
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="AEO24130.1"
/db_xref="GI:346420665"
/translation="SRELQVRGDNPCSEAGAEGQGTLQGTLNCPQITLWQRPLVSIKV
GGQIREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIMIEICGKKAIG
TVLVGPTPVNIIGRNLLTQLGCTLNFPISPIETVPVKLKPGMDGPRVKQWPLTEEKIK
ALTAICEELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEV
QLGIPHPAGLKKRKSMTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQXSMTKILEPFRAKNPDIXIYQYVDDLYVXSDLEIGQHRAKIEELR
AHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQTIQLPEKDSWTVNDIQSL"
gene <1..127
/gene="gag"
CDS <1..127
/gene="gag"
/codon_start="2"
/transl_table="1"
/product="gag protein"
/protein_id="AEO24129.1"
/db_xref="GI:346420664"
/translation="AESFRFEETTPAPKQEPKDKEPYKEPLTALKSLFGSDPLSQ"
BASE COUNT 442 a 201 c 253 g 259 t 9 other
ORIGIN
1 agcagagagc ttcaggttcg aggagacaac ccctgctccg aagcaggagc cgaaggacaa
61 ggaaccctac aaggaaccct taactgccct caaatcactc tttggcagcg accccttgtc
121 tcaataaaag tggggggcca gataagggaa gctctcttag acacaggagc agatgataca
181 gtattagaag atataaattt gccaggaaaa tggaaaccaa aaatgatagg aggaattgga
241 ggttttatca aagtaagaca gtatgatcaa ataatgatag aaatttgtgg aaaaaaggct
301 ataggtacag tattagtagg gcctacacct gtcaacataa ttgggagaaa cctgttgact
361 cagcttggat gtacactaaa ttttccaatt agccccattg aaactgtacc agtaaaactg
421 aagccaggaa tggatggtcc aagggttaaa cagtggccat tgacagaaga aaaaataaaa
481 gcattaacag caatttgtga agaactggag aaggaaggaa aaatttcaaa aattgggcct
541 gaaaatccat ataacactcc agtatttgcc ataaaaaaga aagacagtac taaatggaga
601 aaattagtag aytttaggga actcaataaa aggactcagg atttttggga agttcaatta
661 ggaataccac atccagcagg gttaaaaaag agaaaatcaa tgacagtact ggatgtggga
721 gatgcatatt tttcagttcc tttagatgaa agcttcagga aatatactgc attcacmata
781 cctagtataa acaatgaaac accagggatt agatatcaat ataatgtgct tccacaggga
841 tggaaaggat caccagcaat attccaatst agcatgacaa aaatcttaga gccctttaga
901 gcaaaaaatc cagacatagw catctaycaa tatgtggatg acttgtatgt agsatcagat
961 ttagaaatag grcaacatag agcaaaaata gaggagttaa gagcacatct gttaaagtgg
1021 ggrcttacca caccagacaa gaagcatcag aaagaacccc catttctttg gatggggtat
1081 gaactccatc ctgacaaatg gacagtacag actatacagc tgccagaaaa rgatagctgg
1141 actgtcaatg acatacagag ttta
//
last modified: Tue May 31 10:56 2022