HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    JN638148		    1164 bp    DNA     linear	VRL 26-SEP-2011
DEFINITION  HIV-1 isolate A252 from South Africa pol protein (pol) and gag
	    protein (gag) genes, partial cds
ACCESSION   JN638148
VERSION     JN638148.1 GI:346420663
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 1164)
            Show all sequences for reference 1
  AUTHORS   van Zyl,G., Van der Merwe,L., Claassen,M., Zeier,M. and Preiser,W.
  TITLE     Antiretroviral resistance patterns and factors associated with
	    resistance in adult patients failing NNRTI-based regimens in the
	    western cape, South Africa
  JOURNAL   J. Med. Virol. 83 (10), 1764-1769 (2011)
  PUBMED    21837793
REFERENCE   2 (bases 1 to 1164)
            Show all sequences for reference 2
  AUTHORS   van Zyl,G., Van der Merwe,L., Claassen,M., Zeier,M. and Preiser,W.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-AUG-2011) Division of Medical Virology, Stellenbosch
	    University, Francie van Zijl Drive, Parow 7500, South Africa
COMMENT     Annotation information was provided by the author. Some of the
	    information does not have GenBank feature identifiers and is being
	    provided in the comment section. Information in this section is
	    searchable in HIV Database at Los Alamos (www.hiv.lanl.gov).;
	    ##HIVDataBaseData-START## Sequence name A252 Patient sex Female
	    Patient age 29 Patient comment AZT 3TC EFV CD4 count 210 Viral Load
	    2300 ##HIVDataBaseData-END##
FEATURES             Location/Qualifiers
     source	     1..1164
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /isolate="A252"
		     /host="Homo sapiens"
		     /db_xref="taxon:11676"
		     /country="South Africa"
		     /collection_date="24-Feb-2009"
     gene	     <1..>1164
		     /gene="pol"
     CDS	     <1..>1164
		     /gene="pol"
		     /codon_start="1"
		     /transl_table="1"
		     /product="pol protein"
		     /protein_id="AEO24130.1"
		     /db_xref="GI:346420665"
		     /translation="SRELQVRGDNPCSEAGAEGQGTLQGTLNCPQITLWQRPLVSIKV
		     GGQIREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIMIEICGKKAIG
		     TVLVGPTPVNIIGRNLLTQLGCTLNFPISPIETVPVKLKPGMDGPRVKQWPLTEEKIK
		     ALTAICEELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEV
		     QLGIPHPAGLKKRKSMTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNV
		     LPQGWKGSPAIFQXSMTKILEPFRAKNPDIXIYQYVDDLYVXSDLEIGQHRAKIEELR
		     AHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQTIQLPEKDSWTVNDIQSL"
     gene	     <1..127
		     /gene="gag"
     CDS	     <1..127
		     /gene="gag"
		     /codon_start="2"
		     /transl_table="1"
		     /product="gag protein"
		     /protein_id="AEO24129.1"
		     /db_xref="GI:346420664"
		     /translation="AESFRFEETTPAPKQEPKDKEPYKEPLTALKSLFGSDPLSQ"
BASE COUNT	442 a	 201 c	  253 g    259 t      9 other
ORIGIN
       1 agcagagagc ttcaggttcg aggagacaac ccctgctccg aagcaggagc cgaaggacaa 
      61 ggaaccctac aaggaaccct taactgccct caaatcactc tttggcagcg accccttgtc 
     121 tcaataaaag tggggggcca gataagggaa gctctcttag acacaggagc agatgataca 
     181 gtattagaag atataaattt gccaggaaaa tggaaaccaa aaatgatagg aggaattgga 
     241 ggttttatca aagtaagaca gtatgatcaa ataatgatag aaatttgtgg aaaaaaggct 
     301 ataggtacag tattagtagg gcctacacct gtcaacataa ttgggagaaa cctgttgact 
     361 cagcttggat gtacactaaa ttttccaatt agccccattg aaactgtacc agtaaaactg 
     421 aagccaggaa tggatggtcc aagggttaaa cagtggccat tgacagaaga aaaaataaaa 
     481 gcattaacag caatttgtga agaactggag aaggaaggaa aaatttcaaa aattgggcct 
     541 gaaaatccat ataacactcc agtatttgcc ataaaaaaga aagacagtac taaatggaga 
     601 aaattagtag aytttaggga actcaataaa aggactcagg atttttggga agttcaatta 
     661 ggaataccac atccagcagg gttaaaaaag agaaaatcaa tgacagtact ggatgtggga 
     721 gatgcatatt tttcagttcc tttagatgaa agcttcagga aatatactgc attcacmata 
     781 cctagtataa acaatgaaac accagggatt agatatcaat ataatgtgct tccacaggga 
     841 tggaaaggat caccagcaat attccaatst agcatgacaa aaatcttaga gccctttaga 
     901 gcaaaaaatc cagacatagw catctaycaa tatgtggatg acttgtatgt agsatcagat 
     961 ttagaaatag grcaacatag agcaaaaata gaggagttaa gagcacatct gttaaagtgg 
    1021 ggrcttacca caccagacaa gaagcatcag aaagaacccc catttctttg gatggggtat 
    1081 gaactccatc ctgacaaatg gacagtacag actatacagc tgccagaaaa rgatagctgg 
    1141 actgtcaatg acatacagag ttta
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health