View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS JN125947 291 bp RNA linear VRL 09-NOV-2011
DEFINITION HIV-1 isolate BM-40 from France vpr protein (vpr) gene, complete
cds
ACCESSION JN125947
VERSION JN125947.1 GI:355526242
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 291)
Show all sequences for reference 1
AUTHORS Fourati,S., Malet,I., Guenzel,C.A., Soulie,C., Maidou-Peindara,P.,
Morand-Joubert,L., Wirden,M., Sayon,S., Peytavin,G., Simon,A.,
Katlama,C., Benichou,S., Calvez,V. and Marcelin,A.-G.
TITLE E17A mutation in HIV-1 Vpr confers resistance to didanosine in
association with thymidine analog mutations.
JOURNAL Antiviral. Res.. 93(1); 167-74 (2012)
PUBMED 22138483
REFERENCE 2 (bases 1 to 291)
Show all sequences for reference 2
AUTHORS Fourati,S.
TITLE Direct Submission
JOURNAL Submitted (16-JUN-2011) Virology, INSERM U943, 83, Blvd de
l''Hopital, Paris 75013, France
FEATURES Location/Qualifiers
source 1..291
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="BM-40"
/isolation_source="plasma"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="France"
/collection_date="2008"
gene 1..291
/gene="vpr"
CDS 1..291
/gene="vpr"
/codon_start="1"
/transl_table="1"
/product="vpr protein"
/protein_id="AET05918.1"
/db_xref="GI:355526243"
/translation="MERAPEDQGPQREPYNEWTLELLEELKQEAVRHFPRVWLYGLGQ
YIYETYGDTWAGVEAIIRSLQQLLFIHFRIGCQHSRIGIIPQRRTRNGASRS"
BASE COUNT 97 a 51 c 78 g 65 t
ORIGIN
1 atggaacgag ccccggaaga ccaagggcca cagagggagc catacaatga atggacacta
61 gagcttttag aggagcttaa acaggaagct gttagacatt ttcctagggt gtggctatat
121 ggcttaggac aatatatcta tgaaacctat ggggatactt gggcaggagt ggaggccata
181 ataagaagtc tgcaacaact gctgtttatt catttcagaa ttggatgtca acatagcaga
241 ataggcatta ttccacagag gagaacaaga aatggagcca gtagatccta g
//
last modified: Tue May 31 10:56 2022