View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS JN125937 291 bp RNA linear VRL 09-NOV-2011
DEFINITION HIV-1 isolate BM-22 from France vpr protein (vpr) gene, complete
cds
ACCESSION JN125937
VERSION JN125937.1 GI:355526222
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 291)
Show all sequences for reference 1
AUTHORS Fourati,S., Malet,I., Guenzel,C.A., Soulie,C., Maidou-Peindara,P.,
Morand-Joubert,L., Wirden,M., Sayon,S., Peytavin,G., Simon,A.,
Katlama,C., Benichou,S., Calvez,V. and Marcelin,A.-G.
TITLE E17A mutation in HIV-1 Vpr confers resistance to didanosine in
association with thymidine analog mutations.
JOURNAL Antiviral. Res.. 93(1); 167-74 (2012)
PUBMED 22138483
REFERENCE 2 (bases 1 to 291)
Show all sequences for reference 2
AUTHORS Fourati,S.
TITLE Direct Submission
JOURNAL Submitted (16-JUN-2011) Virology, INSERM U943, 83, Blvd de
l''Hopital, Paris 75013, France
FEATURES Location/Qualifiers
source 1..291
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="BM-22"
/isolation_source="plasma"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="France"
/collection_date="2008"
gene 1..291
/gene="vpr"
CDS 1..291
/gene="vpr"
/codon_start="1"
/transl_table="1"
/product="vpr protein"
/protein_id="AET05908.1"
/db_xref="GI:355526223"
/translation="MEQASEDQGPPREPYVEWTLELLEELKSEAVRHFPRPWLHSLGQ
YIYGTYGDTWAGVKALIRMLQQLLFIHFRIGCQHSRIGIIPQRRARNGASRS"
BASE COUNT 95 a 55 c 75 g 66 t
ORIGIN
1 atggaacaag cctcagaaga ccaaggacca ccgagggagc catacgttga gtggacacta
61 gagcttttag aggagcttaa gagtgaagct gttagacact ttcctagacc atggctccat
121 agcttaggac aatatatcta tggaacttat ggggatactt gggcaggagt aaaggcccta
181 ataagaatgc tgcaacaact gctgtttatt catttcagaa ttgggtgtca acatagcaga
241 ataggcatta ttccacagag gagagcaaga aatggagcca gtagatccta g
//
last modified: Tue May 31 10:56 2022