View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS JN125884 291 bp RNA linear VRL 09-NOV-2011
DEFINITION HIV-1 isolate BN_31_G from France vpr protein (vpr) gene, complete
cds
ACCESSION JN125884
VERSION JN125884.1 GI:355526116
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 291)
Show all sequences for reference 1
AUTHORS Fourati,S., Malet,I., Guenzel,C.A., Soulie,C., Maidou-Peindara,P.,
Morand-Joubert,L., Wirden,M., Sayon,S., Peytavin,G., Simon,A.,
Katlama,C., Benichou,S., Calvez,V. and Marcelin,A.-G.
TITLE E17A mutation in HIV-1 Vpr confers resistance to didanosine in
association with thymidine analog mutations.
JOURNAL Antiviral. Res.. 93(1); 167-74 (2012)
PUBMED 22138483
REFERENCE 2 (bases 1 to 291)
Show all sequences for reference 2
AUTHORS Fourati,S.
TITLE Direct Submission
JOURNAL Submitted (16-JUN-2011) Virology, INSERM U943, 83, Blvd de
l''Hopital, Paris 75013, France
FEATURES Location/Qualifiers
source 1..291
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="BN_31_G"
/isolation_source="plasma"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="France"
/collection_date="2008"
gene 1..291
/gene="vpr"
CDS 1..291
/gene="vpr"
/codon_start="1"
/transl_table="1"
/product="vpr protein"
/protein_id="AET05855.1"
/db_xref="GI:355526117"
/translation="MEQAPEDQGPPREPYNEWALELLEELKNEAVRHFPRVWLHGLGQ
YIYETYGDTWTGVEALIRTLQQLLFIHFRIGCQHSRIGIVRQRRARNGASRS"
BASE COUNT 94 a 51 c 77 g 69 t
ORIGIN
1 atggaacaag ccccagaaga ccaagggcca ccgagggagc catacaatga atgggcacta
61 gagcttttag aggagcttaa gaatgaagct gttagacatt ttcctagggt ttggctccat
121 ggcttagggc aatatatcta tgaaacttat ggggatactt ggacaggagt ggaagcctta
181 ataagaactc tacaacaact gttgtttatt catttcagaa ttgggtgtca acatagcaga
241 ataggcattg ttcgacagag gagagcaaga aatggagcca gtagatccta g
//
last modified: Tue May 31 10:56 2022