View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS JN091697 728 bp RNA linear VRL 12-AUG-2011
DEFINITION Simian immunodeficiency virus isolate UG300 from Tanzania envelope
glycoprotein (env), rev protein (rev), tat protein (tat), and nef
protein (nef) genes, partial cds
ACCESSION JN091697
VERSION JN091697.1 GI:341571960
KEYWORDS .
SOURCE Simian immunodeficiency virus (SIV)
ORGANISM Simian immunodeficiency virus Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 728)
Show all sequences for reference 1
AUTHORS Rudicell,R.S., Piel,A.K., Stewart,F., Moore,D.L., Learn,G.H.,
Li,Y., Takehisa,J., Pintea,L., Shaw,G.M., Moore,J., Sharp,P.M. and
Hahn,B.H.
TITLE High prevalence of simian immunodeficiency virus infection in a
community of savanna chimpanzees.
JOURNAL J. Virol.. 85(19); 9918-28 (2011)
PUBMED 21775446
REFERENCE 2 (bases 1 to 728)
Show all sequences for reference 2
AUTHORS Rudicell,R.S., Piel,A.K., Stewart,F., Moore,D., Learn,G.H., Li,Y.,
Takehisa,J., Pintea,L., Moore,J., Sharp,P.M. and Hahn,B.H.
TITLE Direct Submission
JOURNAL Submitted (03-JUN-2011) Department of Medicine, University of
Alabama at Birmingham, 720 20th St. South, Birmingham, AL 35294,
USA
FEATURES Location/Qualifiers
source 1..728
/organism="Simian immunodeficiency virus"
/mol_type="genomic RNA"
/isolate="UG300"
/isolation_source="feces"
/host="Pan troglodytes schweinfurthii"
/db_xref="taxon:11723"
/country="Tanzania"
/collection_date="22-Feb-2010"
gene <1..481
/gene="env"
CDS <1..481
/gene="env"
/note="gp160"
/codon_start="2"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AEK79619.1"
/db_xref="GI:341571961"
/translation="YMPLFSQIPTQAHQDPEQPEGTAGGGGGTGNVRWTPLHRGFFSV
VWEDLRTLLLWLYQTCQNFGWLLWTILKALRQGIISLTQRLIIVQRDIVLKSRQLFDW
LSNTYSILRTSLIQAIDRLANFTGWWTDLVIAGVIFVAQGIRNIPRRIRQGLEIALN"
gene <23..285
/gene="rev"
CDS <23..285
/gene="rev"
/note="Rev"
/codon_start="3"
/transl_table="1"
/product="rev protein"
/protein_id="AEK79620.1"
/db_xref="GI:341571962"
/translation="PYPSASGSRTARRNRRRRWRNRQRQVDSLAQRILQCRLGGPQDP
PPVALPDLSKLRLAPLDDSESTETGNNQPNTETHYSAERHST"
gene <23..215
/gene="tat"
CDS <23..215
/gene="tat"
/note="Tat"
/codon_start="2"
/transl_table="1"
/product="tat protein"
/protein_id="AEK79621.1"
/db_xref="GI:341571963"
/translation="SLPKRIRIQNSQKEPPEEVEEQATSGGLPCTEDSSVSSGRTSGP
SSCGSTRPVKTSAGSSGRF"
gene 483..>728
/gene="nef"
CDS 483..>728
/gene="nef"
/note="Nef"
/codon_start="1"
/transl_table="1"
/product="nef protein"
/protein_id="AEK79622.1"
/db_xref="GI:341571964"
/translation="MGNIFGKWPGAQRAIQQIHECNPEIKGQASQDLQARGGLTTSTL
GTSADVVNYSQDHSEEEVGFPVRPAVPMRPMTEKLAVD"
BASE COUNT 233 a 167 c 175 g 153 t
ORIGIN
1 ttatatgccc ctgttttcac agatccctac ccaagcgcat caggatccag aacagccaga
61 aggaaccgcc ggaggaggtg gaggaacagg caacgtcagg tggactccct tgcacagagg
121 attcttcagt gtcgtctggg aggacctcag gaccctcctc ctgtggctct accagacctg
181 tcaaaacttc ggctggctcc tctggacgat tctgaaagca ctgagacagg gaataatcag
241 cctaacacag agactcatta tagtgcagag agacatagta cttaaaagta gacaactctt
301 tgactggctt agcaatacct atagtatctt aagaacctcg cttatacagg caatagatag
361 attagctaac ttcacaggct ggtggacgga cttggttata gcaggagtga tatttgtagc
421 tcaaggcatc agaaatatcc caagaagaat tagacagggc ctagaaatag ccttaaatta
481 acatgggaaa tatctttggc aagtggcctg gagcccaaag ggcaatccaa caaatacatg
541 aatgtaatcc tgaaataaaa gggcaagcat cacaggacct ccaggcaagg ggagggttaa
601 ctactagcac cctaggaaca tcagcagatg tagtaaatta ctctcaggac cactctgaag
661 aggaagtagg cttcccagtt aggccagcag tgccaatgag acccatgaca gaaaaactag
721 cagtagat
//
last modified: Tue May 31 10:56 2022