HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    JF906612		    1201 bp    RNA     linear	VRL 14-SEP-2011
DEFINITION  HIV-1 isolate BJ07338 from China pol protein (pol) and gag protein
	    (gag) genes, partial cds
ACCESSION   JF906612
VERSION     JF906612.1 GI:336359957
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 1201)
            Show all sequences for reference 1
  AUTHORS   Ye,J.R., Lu,H.Y., Wang,W.S., Guo,L., Xin,R.L., Yu,S.Q., Wu,T.C.,
	    Zeng,Y. and He,X.
  TITLE     The Prevalence of Drug Resistance Mutations Among Treatment-Naive
	    HIV-Infected Individuals in Beijing, China.
  JOURNAL   AIDS Res Hum Retroviruses. 2011 Aug 10.
  PUBMED    21830915
REFERENCE   2 (bases 1 to 1201)
            Show all sequences for reference 2
  AUTHORS   Ye,J.-R., Lu,H.-Y., Xin,R.-L., Yu,S.-Q., Wang,W.-S., He,X. and
	    Zeng,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-MAY-2011) National Institute for Viral Disease
	    Control and Prevention, China Center for Disease Prevention and
	    Control, Yingxin Street Xuan Wu District, Beijng 100052, China
COMMENT     Annotation information was provided by the author. Some of the
	    information does not have GenBank feature identifiers and is being
	    provided in the comment section. Information in this section is
	    searchable in HIV Database at Los Alamos (www.hiv.lanl.gov).;
	    ##HIVDataBaseData-START## Sequence Name BJ07338 Sample city Beijing
	    Culture method primary Sample tissue plasma Patient sex M Patient
	    age 37 Risk factor SH CD4 count 352 ##HIVDataBaseData-END##
FEATURES             Location/Qualifiers
     source	     1..1201
		     /organism="Human immunodeficiency virus 1"
		     /mol_type="genomic RNA"
		     /isolate="BJ07338"
		     /host="Homo sapiens"
		     /db_xref="taxon:11676"
		     /country="China"
		     /collection_date="01-Sep-2007"
		     /note="subtype: B,C"
     gene	     <1..>1201
		     /gene="pol"
     CDS	     <1..>1201
		     /gene="pol"
		     /codon_start="3"
		     /transl_table="1"
		     /product="pol protein"
		     /protein_id="AEI53745.1"
		     /db_xref="GI:336359959"
		     /translation="NFPQITLWQRPLVAIKIGGQLKEALLDTGADDTVLEDMNLPGRW
		     KPRXIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNFP
		     ISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTP
		     IFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFS
		     VPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQN
		     PDIVIYQYMDDLYVGSDLEIGQHRIKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYE
		     LHPDKWTVQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTD
		     IVPLTEEA"
     gene	     <1..48
		     /gene="gag"
     CDS	     <1..48
		     /gene="gag"
		     /codon_start="1"
		     /transl_table="1"
		     /product="gag protein"
		     /protein_id="AEI53744.1"
		     /db_xref="GI:336359958"
		     /translation="ITSLKSLFGNDPLSQ"
BASE COUNT	460 a	 203 c	  256 g    275 t      7 other
ORIGIN
       1 ataacttccc tcaaatcact ctttggcaac gaccccttgt cgcaataaag ataggggggc 
      61 aattaaagga agctctatta gatacaggag cagatgatac agtattagaa gacatgaatt 
     121 tgccagggag atggaaacca agaaygatag ggggaattgg aggttttatc aaagtaagac 
     181 agtatgacca gatacccata gaaatttgcg gacacaaagc tataggtaca gtattagtgg 
     241 gacctacacc tgtcaacata attggaagaa atctgttgac tcagcttggt tgcactttaa 
     301 attttccaat cagtcccatt gacactgtac cagtaaaatt aaagccagga atggatggcc 
     361 caaaggttaa acaatggcca ttgacagaag agaaaataaa agcattaaca gcaatttgtg 
     421 atgaaatgga gaaggaagga aaaattacaa aaattgggcc tgaaaatcca tataacactc 
     481 caatatttgc tataaaaaag aaggacagta ctaagtggag aaaattagta gatttcaggg 
     541 aactcaataa aaggactcaa gatttttggg aagttcaatt aggaatacca cacccagcag 
     601 ggttaaaaaa gaaaaaatca gtgacagtac tggatgtggg ggatgcatat ttttcagttc 
     661 ctttagataa agayttcagg aaatatactg cattcaccat acctagtata aacaatgaaa 
     721 caccagggat tagatatcag tacaatgtac ttccacaggg atggaaagga tcaccagcaa 
     781 tattccaaag tagcatgaca agaatcttag agcctttcag aaaacaaaat ccagacatag 
     841 ttatctatca atacatggat gatytgtatg taggatcaga cttagagata gggcagcata 
     901 gaataaaaat agaagaactg agacaacatt tgttgaggtg gggatttacc acaccagaca 
     961 agaaacatca gaaagaacct ccatttcttt ggatggggta tgaactccat cctgacaaat 
    1021 ggacagtaca gcctatacag ctgccagaaa argacagctg gacwgtcaat gayatacaaa 
    1081 agttagtggg aaarttaaac tgggcaagtc agatttatcc tggaattaaa gtaaggcaac 
    1141 tttgtaaact ccttaggggg gccaaagcac taacagacat agtaccacta actgaagaag 
    1201 c
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health