View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS JF906612 1201 bp RNA linear VRL 14-SEP-2011
DEFINITION HIV-1 isolate BJ07338 from China pol protein (pol) and gag protein
(gag) genes, partial cds
ACCESSION JF906612
VERSION JF906612.1 GI:336359957
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 1201)
Show all sequences for reference 1
AUTHORS Ye,J.R., Lu,H.Y., Wang,W.S., Guo,L., Xin,R.L., Yu,S.Q., Wu,T.C.,
Zeng,Y. and He,X.
TITLE The Prevalence of Drug Resistance Mutations Among Treatment-Naive
HIV-Infected Individuals in Beijing, China.
JOURNAL AIDS Res Hum Retroviruses. 2011 Aug 10.
PUBMED 21830915
REFERENCE 2 (bases 1 to 1201)
Show all sequences for reference 2
AUTHORS Ye,J.-R., Lu,H.-Y., Xin,R.-L., Yu,S.-Q., Wang,W.-S., He,X. and
Zeng,Y.
TITLE Direct Submission
JOURNAL Submitted (02-MAY-2011) National Institute for Viral Disease
Control and Prevention, China Center for Disease Prevention and
Control, Yingxin Street Xuan Wu District, Beijng 100052, China
COMMENT Annotation information was provided by the author. Some of the
information does not have GenBank feature identifiers and is being
provided in the comment section. Information in this section is
searchable in HIV Database at Los Alamos (www.hiv.lanl.gov).;
##HIVDataBaseData-START## Sequence Name BJ07338 Sample city Beijing
Culture method primary Sample tissue plasma Patient sex M Patient
age 37 Risk factor SH CD4 count 352 ##HIVDataBaseData-END##
FEATURES Location/Qualifiers
source 1..1201
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="BJ07338"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="China"
/collection_date="01-Sep-2007"
/note="subtype: B,C"
gene <1..>1201
/gene="pol"
CDS <1..>1201
/gene="pol"
/codon_start="3"
/transl_table="1"
/product="pol protein"
/protein_id="AEI53745.1"
/db_xref="GI:336359959"
/translation="NFPQITLWQRPLVAIKIGGQLKEALLDTGADDTVLEDMNLPGRW
KPRXIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNFP
ISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTP
IFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFS
VPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQN
PDIVIYQYMDDLYVGSDLEIGQHRIKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYE
LHPDKWTVQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTD
IVPLTEEA"
gene <1..48
/gene="gag"
CDS <1..48
/gene="gag"
/codon_start="1"
/transl_table="1"
/product="gag protein"
/protein_id="AEI53744.1"
/db_xref="GI:336359958"
/translation="ITSLKSLFGNDPLSQ"
BASE COUNT 460 a 203 c 256 g 275 t 7 other
ORIGIN
1 ataacttccc tcaaatcact ctttggcaac gaccccttgt cgcaataaag ataggggggc
61 aattaaagga agctctatta gatacaggag cagatgatac agtattagaa gacatgaatt
121 tgccagggag atggaaacca agaaygatag ggggaattgg aggttttatc aaagtaagac
181 agtatgacca gatacccata gaaatttgcg gacacaaagc tataggtaca gtattagtgg
241 gacctacacc tgtcaacata attggaagaa atctgttgac tcagcttggt tgcactttaa
301 attttccaat cagtcccatt gacactgtac cagtaaaatt aaagccagga atggatggcc
361 caaaggttaa acaatggcca ttgacagaag agaaaataaa agcattaaca gcaatttgtg
421 atgaaatgga gaaggaagga aaaattacaa aaattgggcc tgaaaatcca tataacactc
481 caatatttgc tataaaaaag aaggacagta ctaagtggag aaaattagta gatttcaggg
541 aactcaataa aaggactcaa gatttttggg aagttcaatt aggaatacca cacccagcag
601 ggttaaaaaa gaaaaaatca gtgacagtac tggatgtggg ggatgcatat ttttcagttc
661 ctttagataa agayttcagg aaatatactg cattcaccat acctagtata aacaatgaaa
721 caccagggat tagatatcag tacaatgtac ttccacaggg atggaaagga tcaccagcaa
781 tattccaaag tagcatgaca agaatcttag agcctttcag aaaacaaaat ccagacatag
841 ttatctatca atacatggat gatytgtatg taggatcaga cttagagata gggcagcata
901 gaataaaaat agaagaactg agacaacatt tgttgaggtg gggatttacc acaccagaca
961 agaaacatca gaaagaacct ccatttcttt ggatggggta tgaactccat cctgacaaat
1021 ggacagtaca gcctatacag ctgccagaaa argacagctg gacwgtcaat gayatacaaa
1081 agttagtggg aaarttaaac tgggcaagtc agatttatcc tggaattaaa gtaaggcaac
1141 tttgtaaact ccttaggggg gccaaagcac taacagacat agtaccacta actgaagaag
1201 c
//
last modified: Tue May 31 10:56 2022