View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HQ858109 852 bp RNA linear VRL 21-NOV-2011
DEFINITION HIV-1 isolate ZM176_M_CA_19_6 from Zambia envelope glycoprotein
(env) gene, partial cds
ACCESSION HQ858109
VERSION HQ858109.1 GI:318103933
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 852)
Show all sequences for reference 1
AUTHORS Boeras,D.I., Hraber,P.T., Hurlston,M., Evans-Strickfaden,T.,
Bhattacharya,T., Giorgi,E.E., Mulenga,J., Karita,E., Korber,B.T.,
Allen,S., Hart,C.E., Derdeyn,C.A. and Hunter,E.
TITLE Role of donor genital tract HIV-1 diversity in the transmission
bottleneck
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 108 (46), E1156-E1163 (2011)
PUBMED 22065783
REFERENCE 2 (bases 1 to 852)
Show all sequences for reference 2
AUTHORS Boeras,D., Hraber,P., Hurlston,M., Mulenga,J., Karita,E.,
Korber,B., Giorgi,E., Bhattacharya,T., Hart,C., Allen,S.,
Derdeyn,C. and Hunter,E.
TITLE Direct Submission
JOURNAL Submitted (07-JAN-2011) Emory Vaccine Center, Emory University, 954
Gatewood Road, Atlanta, GA 30329, USA
COMMENT Annotation information was provided by the author. Some of the
information does not have GenBank feature identifiers and is being
provided in the comment section. Information in this section is
searchable in HIV Database at Los Alamos (www.hiv.lanl.gov).;
##HIVDataBaseData-START## Sequence name ZM176_M_CA_19_6 Patient
code ZM176M Sample tissue Cell-associated virus Patient sex M
##HIVDataBaseData-END##
FEATURES Location/Qualifiers
source 1..852
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="ZM176_M_CA_19_6"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="Zambia"
/collection_date="28-Jun-2002"
/note="donor in heterosexual transmission pair subtype: C"
gene <1..>852
/gene="env"
CDS <1..>852
/gene="env"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="ADV41001.1"
/db_xref="GI:318103934"
/translation="CTNATSSNNATNNNDTADNMYRQMKNCSFNATTELRDKSRKEYA
LFYKLDIISLNNNNETSGEYRLINCNTSTITQACPKVSFDPIPIHYCAPAGYAILKCN
NKTFNGMGPCHNVSTVQCTHGIKPVVSTQLLLNGSLAEEGIIIRSENLTDNAKTIIVH
LNESVEIRCIRPGNNTRKSVRIGPGQTFYATGDIIGEMRQAHCNISERDWNKTLQKVG
EKLKERYPNKTIDFKPSSGGDLEITTHSFNCRGEFFYCNTSKLFNVSNLTNITGNASS
DTNITLQC"
BASE COUNT 341 a 144 c 148 g 219 t
ORIGIN
1 tgtactaatg ccacttcaag taataatgct actaataata atgatactgc tgataacatg
61 tatagacaaa tgaaaaactg ctctttcaat gcaactacag aattgagaga taagagtagg
121 aaagaatatg cactttttta taaacttgac ataatatcac ttaataataa taatgagacc
181 tccggtgagt atagattaat aaattgtaat acctcaacca taacacaagc ctgtccaaag
241 gtctcttttg acccaattcc tatacattat tgtgctccag ctggttatgc gattctaaag
301 tgtaataata agacattcaa tggaatggga ccatgccata atgtcagcac agtacaatgt
361 acacatggaa ttaagccagt ggtatcaact caactactgt taaatggtag tttagcagaa
421 gaagggataa taattagatc tgaaaatctg acagacaatg ccaaaacaat aatagtacat
481 cttaatgagt ctgtagaaat tcggtgtata agacccggca ataatacaag aaaaagtgtg
541 aggataggac caggacaaac attctatgca acaggagaca taataggaga gatgagacaa
601 gcacattgta acatcagtga aagggactgg aataaaactt tacaaaaagt aggggaaaaa
661 ttaaaagaac gctaccctaa taaaacaata gattttaagc catcctcagg aggggaccta
721 gaaattacaa cacacagctt taattgtaga ggagaatttt tctattgcaa tacatcaaaa
781 ctatttaatg tatcaaacct gactaacatt acaggaaatg ctagttcaga tacaaacatc
841 acactccaat gc
//
last modified: Tue May 31 10:56 2022