HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    HQ858109		     852 bp    RNA     linear	VRL 21-NOV-2011
DEFINITION  HIV-1 isolate ZM176_M_CA_19_6 from Zambia envelope glycoprotein
	    (env) gene, partial cds
ACCESSION   HQ858109
VERSION     HQ858109.1 GI:318103933
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 852)
            Show all sequences for reference 1
  AUTHORS   Boeras,D.I., Hraber,P.T., Hurlston,M., Evans-Strickfaden,T.,
	    Bhattacharya,T., Giorgi,E.E., Mulenga,J., Karita,E., Korber,B.T.,
	    Allen,S., Hart,C.E., Derdeyn,C.A. and Hunter,E.
  TITLE     Role of donor genital tract HIV-1 diversity in the transmission
	    bottleneck
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (46), E1156-E1163 (2011)
  PUBMED    22065783
REFERENCE   2 (bases 1 to 852)
            Show all sequences for reference 2
  AUTHORS   Boeras,D., Hraber,P., Hurlston,M., Mulenga,J., Karita,E.,
	    Korber,B., Giorgi,E., Bhattacharya,T., Hart,C., Allen,S.,
	    Derdeyn,C. and Hunter,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JAN-2011) Emory Vaccine Center, Emory University, 954
	    Gatewood Road, Atlanta, GA 30329, USA
COMMENT     Annotation information was provided by the author. Some of the
	    information does not have GenBank feature identifiers and is being
	    provided in the comment section. Information in this section is
	    searchable in HIV Database at Los Alamos (www.hiv.lanl.gov).;
	    ##HIVDataBaseData-START## Sequence name ZM176_M_CA_19_6 Patient
	    code ZM176M Sample tissue Cell-associated virus Patient sex M
	    ##HIVDataBaseData-END##
FEATURES             Location/Qualifiers
     source	     1..852
		     /organism="Human immunodeficiency virus 1"
		     /mol_type="genomic RNA"
		     /isolate="ZM176_M_CA_19_6"
		     /host="Homo sapiens"
		     /db_xref="taxon:11676"
		     /country="Zambia"
		     /collection_date="28-Jun-2002"
		     /note="donor in heterosexual transmission pair subtype: C"
     gene	     <1..>852
		     /gene="env"
     CDS	     <1..>852
		     /gene="env"
		     /codon_start="1"
		     /transl_table="1"
		     /product="envelope glycoprotein"
		     /protein_id="ADV41001.1"
		     /db_xref="GI:318103934"
		     /translation="CTNATSSNNATNNNDTADNMYRQMKNCSFNATTELRDKSRKEYA
		     LFYKLDIISLNNNNETSGEYRLINCNTSTITQACPKVSFDPIPIHYCAPAGYAILKCN
		     NKTFNGMGPCHNVSTVQCTHGIKPVVSTQLLLNGSLAEEGIIIRSENLTDNAKTIIVH
		     LNESVEIRCIRPGNNTRKSVRIGPGQTFYATGDIIGEMRQAHCNISERDWNKTLQKVG
		     EKLKERYPNKTIDFKPSSGGDLEITTHSFNCRGEFFYCNTSKLFNVSNLTNITGNASS
		     DTNITLQC"
BASE COUNT	341 a	 144 c	  148 g    219 t
ORIGIN
       1 tgtactaatg ccacttcaag taataatgct actaataata atgatactgc tgataacatg 
      61 tatagacaaa tgaaaaactg ctctttcaat gcaactacag aattgagaga taagagtagg 
     121 aaagaatatg cactttttta taaacttgac ataatatcac ttaataataa taatgagacc 
     181 tccggtgagt atagattaat aaattgtaat acctcaacca taacacaagc ctgtccaaag 
     241 gtctcttttg acccaattcc tatacattat tgtgctccag ctggttatgc gattctaaag 
     301 tgtaataata agacattcaa tggaatggga ccatgccata atgtcagcac agtacaatgt 
     361 acacatggaa ttaagccagt ggtatcaact caactactgt taaatggtag tttagcagaa 
     421 gaagggataa taattagatc tgaaaatctg acagacaatg ccaaaacaat aatagtacat 
     481 cttaatgagt ctgtagaaat tcggtgtata agacccggca ataatacaag aaaaagtgtg 
     541 aggataggac caggacaaac attctatgca acaggagaca taataggaga gatgagacaa 
     601 gcacattgta acatcagtga aagggactgg aataaaactt tacaaaaagt aggggaaaaa 
     661 ttaaaagaac gctaccctaa taaaacaata gattttaagc catcctcagg aggggaccta 
     721 gaaattacaa cacacagctt taattgtaga ggagaatttt tctattgcaa tacatcaaaa 
     781 ctatttaatg tatcaaacct gactaacatt acaggaaatg ctagttcaga tacaaacatc 
     841 acactccaat gc
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health