View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HQ858072 834 bp RNA linear VRL 21-NOV-2011
DEFINITION HIV-1 isolate RW36_F_SW_11 from Rwanda envelope glycoprotein (env)
gene, partial cds
ACCESSION HQ858072
VERSION HQ858072.1 GI:318103860
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 834)
Show all sequences for reference 1
AUTHORS Boeras,D.I., Hraber,P.T., Hurlston,M., Evans-Strickfaden,T.,
Bhattacharya,T., Giorgi,E.E., Mulenga,J., Karita,E., Korber,B.T.,
Allen,S., Hart,C.E., Derdeyn,C.A. and Hunter,E.
TITLE Role of donor genital tract HIV-1 diversity in the transmission
bottleneck
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 108 (46), E1156-E1163 (2011)
PUBMED 22065783
REFERENCE 2 (bases 1 to 834)
Show all sequences for reference 2
AUTHORS Boeras,D., Hraber,P., Hurlston,M., Mulenga,J., Karita,E.,
Korber,B., Giorgi,E., Bhattacharya,T., Hart,C., Allen,S.,
Derdeyn,C. and Hunter,E.
TITLE Direct Submission
JOURNAL Submitted (07-JAN-2011) Emory Vaccine Center, Emory University, 954
Gatewood Road, Atlanta, GA 30329, USA
COMMENT Annotation information was provided by the author. Some of the
information does not have GenBank feature identifiers and is being
provided in the comment section. Information in this section is
searchable in HIV Database at Los Alamos (www.hiv.lanl.gov).;
##HIVDataBaseData-START## Sequence name RW36_F_SW_11 Patient code
RW36F Sample tissue Swab-associated virus Patient sex F
##HIVDataBaseData-END##
FEATURES Location/Qualifiers
source 1..834
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="RW36_F_SW_11"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="Rwanda"
/collection_date="07-Mar-2005"
/note="donor in heterosexual transmission pair subtype:
A1"
gene <1..>834
/gene="env"
CDS <1..>834
/gene="env"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="ADV40965.1"
/db_xref="GI:318103861"
/translation="CNDTNGNVTDREEVKNCTYNVTTELRDKRQNVRSLFYKLDIVPI
DENENNKTCNRTYRLINCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGT
GPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEVIIRSENITDNAKTIIVQFHEAVEI
NCTRPNNNTRKSVRIGPGQAFYATGIIGDIRKAYCTVNRTDWNKALHEVAKKLITYFN
KTKIAFRHSSGGDLEITTHSFNCGGEFFYCNTSELFNSTWNSTDNIQGSNSTEGNITL
PC"
BASE COUNT 327 a 137 c 157 g 213 t
ORIGIN
1 tgtaacgata ccaatggcaa tgtcacggat agggaagaag taaaaaactg cacttacaat
61 gtgaccacag aattaaggga taaaagacag aatgtgcgtt cactttttta taaacttgat
121 atagtgccaa ttgatgaaaa tgaaaataat aagacatgta atagaacgta tagattaata
181 aattgtaata cctcagtcat tacacaggct tgtccaaagg tatcttttga gccaattccc
241 atacattatt gtgccccagc tggttttgcg atcctaaagt gtaataataa gacattcaat
301 ggaacagggc catgcaataa tgtcagcaca gtacaatgca cacatggaat caagccagta
361 gtgtcaaccc aactgctgtt gaatggcagt ctagcagaag aagaggtaat aattagatct
421 gaaaatatca cagataatgc caaaactata atagtacaat ttcatgaggc tgtagaaatt
481 aattgtacta gacctaacaa caatacaaga aaaagtgtac gtataggacc aggacaagca
541 ttctatgcaa caggtataat aggggatata agaaaagcat attgtactgt caatagaaca
601 gactggaata aagctttaca tgaggtagct aaaaaattaa taacatattt taacaaaaca
661 aaaatagcct ttagacattc ttcaggaggg gatctagaaa tcacaacgca tagttttaat
721 tgtggaggag aatttttcta ttgtaataca tcagaactat ttaatagcac ttggaatagc
781 actgacaaca tacagggatc aaacagcacg gagggcaata taactctccc atgc
//
last modified: Tue May 31 10:56 2022