View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HQ528602 288 bp RNA linear VRL 29-NOV-2010
DEFINITION HIV-1 isolate 09002314 from USA pol protein (pol) gene, partial cds
ACCESSION HQ528602
VERSION HQ528602.1 GI:312603654
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 288)
Show all sequences for reference 1
AUTHORS Jain,V. and Spotts,G.
TITLE Direct Submission
JOURNAL Submitted (02-NOV-2010) Medicine - SFGH - Positive Health Program,
University of California San Francisco (UCSF), 995 Potrero Avenue,
4th Floor, San Francisco, CA 94110, USA
REFERENCE 2
Show all sequences for reference 2
AUTHORS Jain,V., Sucupira,M.C., Bacchetti,P., Hartogensis,W., Diaz,R.S.,
Kallas,E.G., Janini,L.M., Liegler,T., Pilcher,C.D., Grant,R.M.,
Cortes,R., Deeks,S.G. and Hecht,F.M.
TITLE Differential Persistence of Transmitted HIV-1 Drug Resistance
Mutation Classes
JOURNAL J. Infect. Dis. 203 (8), 1174-1181 (2011)
PUBMED 21451005
FEATURES Location/Qualifiers
source 1..288
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="09002314"
/isolation_source="plasma"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="USA"
/collection_date="06-Jan-2009"
gene <1..>288
/gene="pol"
CDS <1..>288
/gene="pol"
/note="contains protease"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="ADQ92912.1"
/db_xref="GI:312603655"
/translation="TLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGKWKPKMI
GGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF"
BASE COUNT 109 a 43 c 64 g 72 t
ORIGIN
1 actctttggc aacgacccct cgtcacaata aaagtagggg ggcaactaaa ggaagctcta
61 ttagatacag gagcagatga tacagtatta gaagaaatga atttgccagg aaaatggaaa
121 ccaaaaatga tagggggaat tggaggtttt atcaaagtaa gacagtatga tcagatactc
181 atagaaatat gtggacataa agctataggt acagtattag taggacctac acctgtcaac
241 ataattggaa gaaatctatt gacccagatt ggttgcactt taaatttt
//
last modified: Tue May 31 10:56 2022