View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HQ528582 288 bp RNA linear VRL 29-NOV-2010
DEFINITION HIV-1 isolate 08004761 from USA pol protein (pol) gene, partial cds
ACCESSION HQ528582
VERSION HQ528582.1 GI:312603614
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 288)
Show all sequences for reference 1
AUTHORS Jain,V. and Spotts,G.
TITLE Direct Submission
JOURNAL Submitted (02-NOV-2010) Medicine - SFGH - Positive Health Program,
University of California San Francisco (UCSF), 995 Potrero Avenue,
4th Floor, San Francisco, CA 94110, USA
REFERENCE 2
Show all sequences for reference 2
AUTHORS Jain,V., Sucupira,M.C., Bacchetti,P., Hartogensis,W., Diaz,R.S.,
Kallas,E.G., Janini,L.M., Liegler,T., Pilcher,C.D., Grant,R.M.,
Cortes,R., Deeks,S.G. and Hecht,F.M.
TITLE Differential Persistence of Transmitted HIV-1 Drug Resistance
Mutation Classes
JOURNAL J. Infect. Dis. 203 (8), 1174-1181 (2011)
PUBMED 21451005
FEATURES Location/Qualifiers
source 1..288
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="08004761"
/isolation_source="plasma"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="USA"
/collection_date="12-Jan-2007"
gene <1..>288
/gene="pol"
CDS <1..>288
/gene="pol"
/note="contains protease"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="ADQ92892.1"
/db_xref="GI:312603615"
/translation="TLWQRPLVTIKIGGQLKEALLDTGADNTVFEEMSLPGKWKPKMI
GGIGGFIKVRQYDQVPIEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF"
BASE COUNT 103 a 46 c 67 g 72 t
ORIGIN
1 actctttggc aacgacccct cgtcacaata aagatagggg ggcaactaaa ggaagctcta
61 ttagatacag gagcagataa tacagtattt gaagaaatga gtttgccagg gaaatggaaa
121 ccaaaaatga tagggggaat tggaggtttt atcaaagtaa gacagtatga tcaggtaccc
181 atagaaatct gtggacataa agctataggt acagtattaa taggacctac acctgtcaac
241 ataattggaa gagatctgtt gactcagctt ggttgcacct taaatttt
//
last modified: Tue May 31 10:56 2022