View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HQ315914 210 bp RNA linear VRL 22-NOV-2010
DEFINITION HIV-1 isolate 285.B from Brazil gag protein (gag) gene, partial cds
ACCESSION HQ315914
VERSION HQ315914.1 GI:312193495
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 210)
Show all sequences for reference 1
AUTHORS Martins,A.N., Arruda,M.B., Pires,A.F., Tanuri,A. and Brindeiro,R.M.
TITLE Accumulation of P(T/S)AP late domain duplications in HIV-1 subtypes
B, C and F derived from individuals failing ARV therapy and ARV
drug-naive patients.
JOURNAL AIDS Res Hum Retroviruses. 2010 Nov 18.
PUBMED 21083435
REFERENCE 2 (bases 1 to 210)
Show all sequences for reference 2
AUTHORS Martins,A.N., Arruda,M.B., Pires,A.F., Tanuri,A. and Brindeiro,R.M.
TITLE Direct Submission
JOURNAL Submitted (24-SEP-2010) Genetics, Federal University of Rio de
Janeiro, Street Carlos Chagas Filho 373 CCS sala 121, Rio de
Janeiro, Rio de Janeiro 21949-902, Brazil
FEATURES Location/Qualifiers
source 1..210
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="285.B"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="Brazil"
gene <1..204
/gene="gag"
CDS <1..204
/gene="gag"
/note="p1"
/codon_start="1"
/transl_table="1"
/product="gag protein"
/protein_id="ADQ44186.1"
/db_xref="GI:312193496"
/translation="FLGKIWPSSKGRPGNFLQSRPEPTAPPEESVRFGEETATPSQKQ
ELIDRDKEMYPLTSLKSLFGNDQ"
BASE COUNT 66 a 52 c 51 g 41 t
ORIGIN
1 tttttaggga agatctggcc ttcctccaaa ggaaggccgg gaaattttct tcagagcaga
61 ccagagccaa cagccccacc agaggagagc gtcaggtttg gggaagagac agcaactccc
121 tctcagaagc aagagctgat agacagggac aaggaaatgt atcctttaac ttccctcaaa
181 tcactctttg gcaacgacca gtagtcaaaa
//
last modified: Tue May 31 10:56 2022