View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HQ110629 215 bp DNA linear VRL 03-NOV-2010
DEFINITION HIV-1 clone NII-GTB-IND-TatN16 from India tat protein (tat) gene,
exon 1 and partial cds
ACCESSION HQ110629
VERSION HQ110629.1 GI:310769926
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 215)
Show all sequences for reference 1
AUTHORS Ronsard,L., Lata,S., Singh,J., Ramachandran,V.G., Das,S. and
Banerjea,A.C.
TITLE Molecular and genetic characterization of natural HIV-1 Tat Exon-1
variants from North India and their functional implications.
JOURNAL PLoS. One.. 9(1); e85452 (2014)
PUBMED 24465566
REFERENCE 2 (bases 1 to 215)
Show all sequences for reference 2
AUTHORS Ronsard,L.M., Sood,V., Das,S., Ramachandran,V.G. and Banerjea,A.C.
TITLE Direct Submission
JOURNAL Submitted (09-AUG-2010) Virology II, National Institute of
Immunology, Aruna Asaf Ali Marg, New Delhi, Delhi 110067, India
REFERENCE 3
Show all sequences for reference 3
AUTHORS Neogi,U., Sood,V., Ronsard,L., Singh,J., Lata,S.,
Ramachandran,V.G., Das,S., Wanchu,A. and Banerjea,A.C.
TITLE Genetic architecture of HIV-1 genes circulating in north India &
their functional implications.
JOURNAL Indian. J. Med. Res.. 134(6); 769-78 (2011)
PUBMED 22310812
FEATURES Location/Qualifiers
source 1..215
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/host="Homo sapiens"
/db_xref="taxon:11676"
/clone="NII-GTB-IND-TatN16"
/country="India"
/collection_date="2009"
/note="subtype: C"
gene 1..>215
/gene="tat"
CDS 1..>215
/gene="tat"
/note="trans-activator of transcription; regulatory
protein"
/codon_start="1"
/transl_table="1"
/product="tat protein"
/protein_id="ADP21496.1"
/db_xref="GI:310769927"
/translation="MEPVDPNLEPWNHPGSQPKTACNTCYCKYCSYHCPVCFQTKGLS
ISYGRKKRRQRRSAPQSSEDHQNLISK"
exon 1..215
/gene="tat"
/number="1"
BASE COUNT 71 a 50 c 46 g 48 t
ORIGIN
1 atggagccag tagatcctaa cctagagccc tggaaccatc caggaagtca gcctaaaact
61 gcttgcaata catgctattg taaatactgt agctaccatt gtccagtttg ctttcagaca
121 aaaggcttaa gcatttccta tggcaggaag aagcggagac agcgacgaag cgctcctcaa
181 agcagtgagg atcatcaaaa tcttatatca aagca
//
last modified: Tue May 31 10:56 2022