HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    HQ012295		     760 bp    DNA     linear	VRL 19-APR-2011
DEFINITION  HIV-1 isolate 10ZA_SAVE1219 from South Africa reverse transcriptase
	    (pol) gene, partial cds
ACCESSION   HQ012295
VERSION     HQ012295.1 GI:328905093
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 760)
            Show all sequences for reference 1
  AUTHORS   El-Khatib,Z., DeLong,A., Katzenstein,D., Ekstrom,A.M., Ledwaba,J.,
	    Mohapi,L., Laher,F., Charalambous,S., Karstaedt,A., Petzold,M.,
	    Morris,L. and Kantor,R.
  TITLE     Viremia and drug resistance among HIV-1 patients on antiretroviral
	    treatment: a cross-sectional study in Soweto, South Africa
  JOURNAL   AIDS 24 (11), 1679-1687 (2010)
  PUBMED    20453629
REFERENCE   2 (bases 1 to 760)
            Show all sequences for reference 2
  AUTHORS   El-Khatib,Z., DeLong,A.K., Katzenstein,D., Ekstrom,A.M.,
	    Ledwaba,J., Mohapi,L., Laher,F., Petzold,M., Morris,L. and
	    Kantor,R.
  TITLE     Drug resistance patterns and virus re-suppression among HIV-1
	    subtype C infected patients receiving non-nucleoside reverse
	    transcriptase inhibitors in South Africa.
  JOURNAL   J AIDS Clin Res. 2011 Feb 18;2(117). pii: 1000117.
  PUBMED    21927716
REFERENCE   3 (bases 1 to 760)
            Show all sequences for reference 3
  AUTHORS   El-Khatib,Z., DeLong,A., Katzenstein,D., Ekstrom,A.M., Ledwaba,J.,
	    Mohapi,L., Laher,F., Charalambous,S., Karstaedt,A., Petzold,M.,
	    Morris,L. and Kantor,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-AUG-2010) National Institute for Communicable
	    Diseases (NICD), Virus Research Unit, Private Bag X4, Johannesburg,
	    Gauteng 2131, South Africa
REFERENCE   4
            Show all sequences for reference 4
  AUTHORS   Ledwaba,J., Sayed,Y., Pillay,V., Morris,L. and Hunt,G.
  TITLE     Low Frequency of Protease Inhibitor Resistance Mutations and
	    Insertions in HIV-1 Subtype C Protease Inhibitor-Naive Sequences.
  JOURNAL   AIDS Res. Hum. Retroviruses. 35(7); 673-678 (2019)
  PUBMED    30793914
FEATURES             Location/Qualifiers
     source	     1..760
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /isolate="10ZA_SAVE1219"
		     /host="Homo sapiens"
		     /db_xref="taxon:11676"
		     /country="South Africa"
		     /collection_date="06-May-2008"
     gene	     <1..>760
		     /gene="pol"
     CDS	     <1..>760
		     /gene="pol"
		     /codon_start="1"
		     /transl_table="1"
		     /product="reverse transcriptase"
		     /protein_id="AEB54822.1"
		     /db_xref="GI:328905094"
		     /translation="ETVPVKLKPGMDGPXVKQWPLTEEKLKALIEICKEMEKEGKISK
		     IGPENPYNTPVFXIKKKDSTKWRKLXDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVT
		     ILDVGDAYFSVPLDEGFRKYTAFTIPSINNETPGLRYQYNVLPQGWKGSPAIFQSSMT
		     KILEPFRTQNPEIVIYQYVDDLYVGSDLEIGQHRAKVEELRDHLLKWGFXTPDKKXQK
		     EPPFXWMGYELHPDKWTVQPIQLPEKDSWTVNDIQ"
BASE COUNT	304 a	 126 c	  155 g    169 t      6 other
ORIGIN
       1 gaaactgtac cagtaaaatt aaagccagga atggatggcc caarggttaa acaatggcca 
      61 ttgacagaag aaaaattaaa agcattaata gaaatttgta aagaaatgga aaaggaagga 
     121 aaaatttcaa aaattgggcc tgaaaatcca tataacaccc cagtatttgy cataaaaaag 
     181 aaggacagta ctaagtggag aaaattarta gatttcagag aactcaataa gagaactcaa 
     241 gacttttggg aagttcaact aggaatacca cacccagcag gattaaaaaa gaataaatca 
     301 gtgacaatac tggatgtggg ggatgcatat ttttcagttc ctttagatga aggcttcagg 
     361 aaatatactg cattcaccat acctagtata aataatgaaa caccaggact tagatatcaa 
     421 tataatgtgc ttccacaggg atggaaagga tcaccagcaa tattccagag tagcatgaca 
     481 aaaatcctag agcccttcag gacacaaaac ccagaaatag tcatctatca atatgtggat 
     541 gacttgtatg taggatctga cttggaaata gggcaacata gagcaaaggt agaggagtta 
     601 agagaccatc tattaaagtg gggatttayc acaccagaca aaaaayatca gaaagaaccc 
     661 ccatttcktt ggatgggata tgaactccat cctgacaaat ggacagtaca gcctatccag 
     721 ttgccagaaa aggatagctg gactgttaat gatatacaga 
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health