View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS GQ925949 246 bp RNA linear VRL 10-DEC-2009
DEFINITION HIV-1 isolate CH077 from USA vpu protein (vpu) gene, complete cds;
and envelope glycoprotein (env) gene, partial cds
ACCESSION GQ925949
VERSION GQ925949.1 GI:260586652
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 246)
Show all sequences for reference 1
AUTHORS Sauter,D., Schindler,M., Specht,A., Landford,W.N., Munch,J.,
Kim,K.A., Votteler,J., Schubert,U., Bibollet-Ruche,F., Keele,B.F.,
Takehisa,J., Ogando,Y., Ochsenbauer,C., Kappes,J.C., Ayouba,A.,
Peeters,M., Learn,G.H., Shaw,G., Sharp,P.M., Bieniasz,P.,
Hahn,B.H., Hatziioannou,T. and Kirchhoff,F.
TITLE Tetherin-driven adaptation of Vpu and Nef function and the
evolution of pandemic and nonpandemic HIV-1 strains
JOURNAL Cell Host Microbe 6 (5), 409-421 (2009)
PUBMED 19917496
REFERENCE 2 (bases 1 to 246)
Show all sequences for reference 2
AUTHORS Sauter,D., Schindler,M., Specht,A., Landford,W., Muench,J.,
Kim,K.-A., Votteler,J., Schubert,U., Bibollet-Ruche,F., Keele,B.F.,
Takehisa,J., Ogando,Y., Ochsenbauer,C., Kappes,J.C., Ayouba,A.,
Peeters,M., Learn,G.H., Shaw,G., Sharp,P.M., Bieniasz,P.,
Hahn,B.H., Hatziioannou,T. and Kirchhoff,F.
TITLE Direct Submission
JOURNAL Submitted (17-SEP-2009) Institute of Virology, University of Ulm,
Albert Einstein Allee 11, Ulm 89081, Germany
FEATURES Location/Qualifiers
source 1..246
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="CH077"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="USA"
/collection_date="2006"
/note="subtype: B; group: M"
gene 1..246
/gene="vpu"
CDS 1..246
/gene="vpu"
/codon_start="1"
/transl_table="1"
/product="vpu protein"
/protein_id="ACX46163.1"
/db_xref="GI:260586653"
/translation="MQSLYILGIVALVVAAILAIVVWTIVYIEYRKIVRQRKIDRLLD
RIIDRAEDSGNESEGDQEELSALMEMGHHAPWVIDDQ"
gene 164..>246
/gene="env"
CDS 164..>246
/gene="env"
/note="gp160 surface glycoprotein"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="ACX46164.1"
/db_xref="GI:260586654"
/translation="MRARVIRRNCQHLWRWGTMLLGLLMIS"
BASE COUNT 92 a 28 c 64 g 62 t
ORIGIN
1 atgcaatctt tatatatatt aggaatagta gcattagtag tagcagcaat attagcaata
61 gttgtgtgga ccatagtata catagaatat aggaaaatag taagacaaag gaaaatagac
121 agattacttg atagaataat agacagagca gaagacagtg gcaatgagag cgagggtgat
181 caggaggaat tgtcagcact tatggagatg gggcaccatg ctccttgggt tattgatgat
241 cagtag
//
last modified: Tue May 31 10:56 2022