HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    GQ925949		     246 bp    RNA     linear	VRL 10-DEC-2009
DEFINITION  HIV-1 isolate CH077 from USA vpu protein (vpu) gene, complete cds;
	    and envelope glycoprotein (env) gene, partial cds
ACCESSION   GQ925949
VERSION     GQ925949.1 GI:260586652
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 246)
            Show all sequences for reference 1
  AUTHORS   Sauter,D., Schindler,M., Specht,A., Landford,W.N., Munch,J.,
	    Kim,K.A., Votteler,J., Schubert,U., Bibollet-Ruche,F., Keele,B.F.,
	    Takehisa,J., Ogando,Y., Ochsenbauer,C., Kappes,J.C., Ayouba,A.,
	    Peeters,M., Learn,G.H., Shaw,G., Sharp,P.M., Bieniasz,P.,
	    Hahn,B.H., Hatziioannou,T. and Kirchhoff,F.
  TITLE     Tetherin-driven adaptation of Vpu and Nef function and the
	    evolution of pandemic and nonpandemic HIV-1 strains
  JOURNAL   Cell Host Microbe 6 (5), 409-421 (2009)
  PUBMED    19917496
REFERENCE   2 (bases 1 to 246)
            Show all sequences for reference 2
  AUTHORS   Sauter,D., Schindler,M., Specht,A., Landford,W., Muench,J.,
	    Kim,K.-A., Votteler,J., Schubert,U., Bibollet-Ruche,F., Keele,B.F.,
	    Takehisa,J., Ogando,Y., Ochsenbauer,C., Kappes,J.C., Ayouba,A.,
	    Peeters,M., Learn,G.H., Shaw,G., Sharp,P.M., Bieniasz,P.,
	    Hahn,B.H., Hatziioannou,T. and Kirchhoff,F.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-SEP-2009) Institute of Virology, University of Ulm,
	    Albert Einstein Allee 11, Ulm 89081, Germany
FEATURES             Location/Qualifiers
     source	     1..246
		     /organism="Human immunodeficiency virus 1"
		     /mol_type="genomic RNA"
		     /isolate="CH077"
		     /host="Homo sapiens"
		     /db_xref="taxon:11676"
		     /country="USA"
		     /collection_date="2006"
		     /note="subtype: B; group: M"
     gene	     1..246
		     /gene="vpu"
     CDS	     1..246
		     /gene="vpu"
		     /codon_start="1"
		     /transl_table="1"
		     /product="vpu protein"
		     /protein_id="ACX46163.1"
		     /db_xref="GI:260586653"
		     /translation="MQSLYILGIVALVVAAILAIVVWTIVYIEYRKIVRQRKIDRLLD
		     RIIDRAEDSGNESEGDQEELSALMEMGHHAPWVIDDQ"
     gene	     164..>246
		     /gene="env"
     CDS	     164..>246
		     /gene="env"
		     /note="gp160 surface glycoprotein"
		     /codon_start="1"
		     /transl_table="1"
		     /product="envelope glycoprotein"
		     /protein_id="ACX46164.1"
		     /db_xref="GI:260586654"
		     /translation="MRARVIRRNCQHLWRWGTMLLGLLMIS"
BASE COUNT	 92 a	  28 c	   64 g     62 t
ORIGIN
       1 atgcaatctt tatatatatt aggaatagta gcattagtag tagcagcaat attagcaata 
      61 gttgtgtgga ccatagtata catagaatat aggaaaatag taagacaaag gaaaatagac 
     121 agattacttg atagaataat agacagagca gaagacagtg gcaatgagag cgagggtgat 
     181 caggaggaat tgtcagcact tatggagatg gggcaccatg ctccttgggt tattgatgat 
     241 cagtag
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health