View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS GQ868870 630 bp DNA linear VRL 10-OCT-2009
DEFINITION HIV-1 isolate BW0311B from USA nef protein (nef) gene, partial cds
ACCESSION GQ868870
VERSION GQ868870.1 GI:260514121
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 630)
Show all sequences for reference 1
AUTHORS Lamers,S.L., Salemi,M., Galligan,D.C., Morris,A., Gray,R.,
Fogel,G., Zhao,L. and McGrath,M.S.
TITLE Human immunodeficiency virus-1 evolutionary patterns associated
with pathogenic processes in the brain.
JOURNAL J. Neurovirol.. 16(3); 230-41 (2010)
PUBMED 20367240
REFERENCE 2 (bases 1 to 630)
Show all sequences for reference 2
AUTHORS Lamers,S.L., Salemi,M., Galligan,D., Morris,A., Gray,R., Fogel,G.,
de Oliveira,T., Zhao,L. and McGrath,M.
TITLE Direct Submission
JOURNAL Submitted (02-SEP-2009) Department of Laboratory Medicine, Positive
Health Program, University of California, San Francisco, San
Francisco, CA 94110, USA
FEATURES Location/Qualifiers
source 1..630
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="BW0311B"
/isolation_source="brain"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="USA"
/collection_date="2001"
gene <1..>630
/gene="nef"
CDS <1..>630
/gene="nef"
/codon_start="1"
/transl_table="1"
/product="nef protein"
/protein_id="ACX42771.1"
/db_xref="GI:260514122"
/translation="GGKWSKRTGDGWPAVRERMRRTEPRRRTEPAAVGVGAASRDLEK
HGAITTSNTAATNSDVAWLEAQEDEEVGFPVRPQVPLRPMNYKGALDLSHFLREKGGL
EGLVHSQKRQDILDLWVYHTQGYFPDWQNYTPGPGTRFPLTFGWCFKLVPIDPDKVEE
ATEGEDNSLLHPMNQHGMDDPEKEVLVWKFDSSLAFHHVAREKHPEYYKD"
BASE COUNT 192 a 142 c 177 g 119 t
ORIGIN
1 ggtggcaagt ggtcaaaacg cactggggat ggatggcctg ctgtaaggga aagaatgcga
61 cgcactgagc caaggcgacg cactgagcca gcagcagttg gggtaggagc agcatctaga
121 gacctagaaa aacatggggc aatcacaact agcaatacag cagctaccaa tagtgacgtt
181 gcctggctag aagcacaaga ggatgaggaa gtgggatttc cagtcagacc tcaggtacct
241 ttgagaccaa tgaattacaa gggagcttta gatcttagcc actttttaag agaaaagggg
301 ggactggaag ggttagttca ctcccagaaa agacaggata tccttgatct gtgggtctac
361 cacacacaag gctacttccc tgattggcag aactacacac cagggccagg gactcgattt
421 cccctgacct ttggatggtg cttcaagcta gtaccaattg acccagacaa ggtagaagag
481 gccactgaag gagaggacaa cagcttgtta caccctatga accagcatgg gatggatgac
541 ccagagaaag aagtgttagt gtggaagttt gacagcagcc tcgcctttca ccacgtagcc
601 cgagagaaac atccggagta ctacaaggac
//
last modified: Tue May 31 10:56 2022