View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS FJ520328 706 bp DNA linear VRL 24-APR-2009
DEFINITION HIV-1 isolate i11bclone25 from India pol protein (pol) gene,
partial cds
ACCESSION FJ520328
VERSION FJ520328.1 GI:226993440
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 706)
Show all sequences for reference 1
AUTHORS Moorthy,A., Gupta,A., Bhosale,R., Tripathy,S., Sastry,J.,
Kulkarni,S., Thakar,M., Bharadwaj,R., Kagal,A., Bhore,A.V.,
Patil,S., Kulkarni,V., Venkataramani,V., Balasubramaniam,U.,
Suryavanshi,N., Ziemniak,C., Gupte,N., Bollinger,R. and Persaud,D.
TITLE Nevirapine resistance and breast-milk HIV transmission: effects of
single and extended-dose nevirapine prophylaxis in subtype C
HIV-infected infants
JOURNAL PLoS ONE 4 (1), E4096 (2009)
PUBMED 19119321
REFERENCE 2 (bases 1 to 706)
Show all sequences for reference 2
AUTHORS Foley,B.T.
TITLE Direct Submission
JOURNAL Submitted (03-DEC-2008) Los Alamos National Laboratory, Theoretical
Biology and Biophysics (T10), MSK710, Los Alamos, NM 87544, USA
COMMENT Annotation information was provided by the author. Some of the
information does not have GenBank feature identifiers and is being
provided in the comment section. Information in this section is
searchable in HIV Database at Los Alamos (www.hiv.lanl.gov).;
##HIVDataBaseData-START## Sequence Name i11bclone25 Patient code
i11b Sample date 09/2006 Isolate name clone25 Sample Timepoint
52wks Sample city Pune Subtype C DBID 1421655702
##HIVDataBaseData-END##
FEATURES Location/Qualifiers
source 1..706
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="i11bclone25"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="India"
/collection_date="Sep-2006"
/note="subtype: C"
gene <1..>706
/gene="pol"
CDS <1..>706
/gene="pol"
/codon_start="3"
/transl_table="1"
/product="pol protein"
/protein_id="ACP00125.1"
/db_xref="GI:226993441"
/translation="PIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKI
TRIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRAQDFWEVQLGIPHPAGLKKKKS
VTVLDVGDAYFSVPLYEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQAS
MTKILEPFRKQNPDIVIYQYMDDLYVGSDLELGQHRAKIEELRGHLLRWGFTTPDKKH
QKEPPFLWMGYELHPD"
BASE COUNT 278 a 117 c 150 g 161 t
ORIGIN
1 gtcctattga aactgtacca gtaaaattaa agccaggaat ggatggccca aaggttaaac
61 aatggccatt gacagaagaa aaaataaaag cattaacagc aatttgtgag gaaatggaaa
121 aggaaggaaa aattacaaga attgggcctg agaatccata taacactcca atatttgcca
181 taaaaaagaa ggacagtact aaatggagaa aattagtaga tttcagggaa ctcaataaaa
241 gagctcaaga tttttgggaa gttcagttag gaataccgca cccagcaggg ttaaaaaaga
301 aaaaatcagt gacagtactg gatgtggggg atgcatattt ttcagttcca ttatatgaag
361 gcttcaggaa atatactgca tttaccatac ctagtacaaa caatgaaaca ccagggatta
421 ggtatcaata taatgtgctt ccacagggat ggaaaggatc accagcaata tttcaggcta
481 gcatgacaaa aatcctagag ccctttagaa aacaaaatcc agacatagtc atctatcaat
541 atatggatga cttgtatgta ggatctgact tagaactagg gcaacataga gcaaaaatag
601 aggagttaag aggacatctg ttaaggtggg gattcaccac accagacaag aaacatcaga
661 aagaaccccc atttctttgg atggggtatg aactccatcc tgataa
//
last modified: Tue May 31 10:56 2022