HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    FJ520328		     706 bp    DNA     linear	VRL 24-APR-2009
DEFINITION  HIV-1 isolate i11bclone25 from India pol protein (pol) gene,
	    partial cds
ACCESSION   FJ520328
VERSION     FJ520328.1 GI:226993440
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 706)
            Show all sequences for reference 1
  AUTHORS   Moorthy,A., Gupta,A., Bhosale,R., Tripathy,S., Sastry,J.,
	    Kulkarni,S., Thakar,M., Bharadwaj,R., Kagal,A., Bhore,A.V.,
	    Patil,S., Kulkarni,V., Venkataramani,V., Balasubramaniam,U.,
	    Suryavanshi,N., Ziemniak,C., Gupte,N., Bollinger,R. and Persaud,D.
  TITLE     Nevirapine resistance and breast-milk HIV transmission: effects of
	    single and extended-dose nevirapine prophylaxis in subtype C
	    HIV-infected infants
  JOURNAL   PLoS ONE 4 (1), E4096 (2009)
  PUBMED    19119321
REFERENCE   2 (bases 1 to 706)
            Show all sequences for reference 2
  AUTHORS   Foley,B.T.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2008) Los Alamos National Laboratory, Theoretical
	    Biology and Biophysics (T10), MSK710, Los Alamos, NM 87544, USA
COMMENT     Annotation information was provided by the author. Some of the
	    information does not have GenBank feature identifiers and is being
	    provided in the comment section. Information in this section is
	    searchable in HIV Database at Los Alamos (www.hiv.lanl.gov).;
	    ##HIVDataBaseData-START## Sequence Name i11bclone25 Patient code
	    i11b Sample date 09/2006 Isolate name clone25 Sample Timepoint
	    52wks Sample city Pune Subtype C DBID 1421655702
	    ##HIVDataBaseData-END##
FEATURES             Location/Qualifiers
     source	     1..706
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /isolate="i11bclone25"
		     /host="Homo sapiens"
		     /db_xref="taxon:11676"
		     /country="India"
		     /collection_date="Sep-2006"
		     /note="subtype: C"
     gene	     <1..>706
		     /gene="pol"
     CDS	     <1..>706
		     /gene="pol"
		     /codon_start="3"
		     /transl_table="1"
		     /product="pol protein"
		     /protein_id="ACP00125.1"
		     /db_xref="GI:226993441"
		     /translation="PIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKI
		     TRIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRAQDFWEVQLGIPHPAGLKKKKS
		     VTVLDVGDAYFSVPLYEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQAS
		     MTKILEPFRKQNPDIVIYQYMDDLYVGSDLELGQHRAKIEELRGHLLRWGFTTPDKKH
		     QKEPPFLWMGYELHPD"
BASE COUNT	278 a	 117 c	  150 g    161 t
ORIGIN
       1 gtcctattga aactgtacca gtaaaattaa agccaggaat ggatggccca aaggttaaac 
      61 aatggccatt gacagaagaa aaaataaaag cattaacagc aatttgtgag gaaatggaaa 
     121 aggaaggaaa aattacaaga attgggcctg agaatccata taacactcca atatttgcca 
     181 taaaaaagaa ggacagtact aaatggagaa aattagtaga tttcagggaa ctcaataaaa 
     241 gagctcaaga tttttgggaa gttcagttag gaataccgca cccagcaggg ttaaaaaaga 
     301 aaaaatcagt gacagtactg gatgtggggg atgcatattt ttcagttcca ttatatgaag 
     361 gcttcaggaa atatactgca tttaccatac ctagtacaaa caatgaaaca ccagggatta 
     421 ggtatcaata taatgtgctt ccacagggat ggaaaggatc accagcaata tttcaggcta 
     481 gcatgacaaa aatcctagag ccctttagaa aacaaaatcc agacatagtc atctatcaat 
     541 atatggatga cttgtatgta ggatctgact tagaactagg gcaacataga gcaaaaatag 
     601 aggagttaag aggacatctg ttaaggtggg gattcaccac accagacaag aaacatcaga 
     661 aagaaccccc atttctttgg atggggtatg aactccatcc tgataa
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health