View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS FJ430456 447 bp RNA linear VRL 16-DEC-2008
DEFINITION HIV-1 isolate ES9plasma3 from USA nef protein (nef) gene, partial
cds
ACCESSION FJ430456
VERSION FJ430456.1 GI:217323187
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 447)
Show all sequences for reference 1
AUTHORS Bailey,J.R., Brennan,T.P., O'Connell,K.A., Siliciano,R.F. and
Blankson,J.N.
TITLE Evidence of CD8+ T-cell-mediated selective pressure on human
immunodeficiency virus type 1 nef in HLA-B*57+ elite suppressors.
JOURNAL J. Virol.. 83(1); 88-97 (2009)
PUBMED 18945771
REFERENCE 2 (bases 1 to 447)
Show all sequences for reference 2
AUTHORS Blankson,J.N.
TITLE Direct Submission
JOURNAL Submitted (31-OCT-2008) Medicine, Johns Hopkins University School
of Medicine, 733 N Broadway, Baltimore, MD 21205, USA
REFERENCE 3
Show all sequences for reference 3
AUTHORS Salgado,M., Brennan,T.P., O'Conell,K.A., Bailey,J.R., Ray,S.C.,
Siliciano,R.F. and Blankson,J.N.
TITLE Evolution of the HIV-1 nef gene in HLA-B*57 Positive Elite
Suppressors
JOURNAL Retrovirology 7 (1), 94 (2010)
PUBMED 21059238
FEATURES Location/Qualifiers
source 1..447
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="ES9plasma3"
/db_xref="taxon:11676"
/country="USA"
/note="collected 2004-2005"
gene 1..>447
/gene="nef"
CDS 1..>447
/gene="nef"
/codon_start="1"
/transl_table="1"
/product="nef protein"
/protein_id="ACK38003.1"
/db_xref="GI:217323188"
/translation="MGSKWSKSSVVGWPGVRERMRRAEPAADGVGAVSRDLEKHGAIT
SSNTAATNADCAWIEAQEEEEVGFPVRPQVPLRPMTYKGALDLSHFLKEKGGLEGLIH
SQRRQDILDLWVYNTQGYFPDWQNYTPGPGIRYPLTFGWCFKQGRIL"
BASE COUNT 138 a 84 c 129 g 96 t
ORIGIN
1 atgggtagta agtggtcaaa aagtagtgtg gttggatggc ctggggtaag ggaaagaatg
61 agacgagctg agccagcagc agatggggtg ggagcagtat ctcgagacct agaaaaacat
121 ggagcaatca caagtagcaa tacagcagct accaatgctg attgtgcttg gatagaagca
181 caagaggagg aggaggtggg ttttccagtc aggcctcaag tacctttaag accaatgact
241 tacaagggag ctttagatct tagccacttt ttaaaagaaa aggggggact ggaagggcta
301 attcactctc aaagaagaca agatatcctt gatttgtggg tctacaacac acaaggctac
361 ttccctgatt ggcagaacta cacaccaggg ccagggatcc gatatccact gacctttgga
421 tggtgcttca agcaagggcg aattctg
//
last modified: Tue May 31 10:56 2022