View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS FJ430383 621 bp DNA linear VRL 16-DEC-2008
DEFINITION HIV-1 isolate ES9provirus4 from USA nef protein (nef) gene,
complete cds
ACCESSION FJ430383
VERSION FJ430383.1 GI:217323042
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 621)
Show all sequences for reference 1
AUTHORS Bailey,J.R., Brennan,T.P., O'Connell,K.A., Siliciano,R.F. and
Blankson,J.N.
TITLE Evidence of CD8+ T-cell-mediated selective pressure on human
immunodeficiency virus type 1 nef in HLA-B*57+ elite suppressors.
JOURNAL J. Virol.. 83(1); 88-97 (2009)
PUBMED 18945771
REFERENCE 2 (bases 1 to 621)
Show all sequences for reference 2
AUTHORS Blankson,J.N.
TITLE Direct Submission
JOURNAL Submitted (31-OCT-2008) Medicine, Johns Hopkins University School
of Medicine, 733 N Broadway, Baltimore, MD 21205, USA
REFERENCE 3
Show all sequences for reference 3
AUTHORS Salgado,M., Brennan,T.P., O'Conell,K.A., Bailey,J.R., Ray,S.C.,
Siliciano,R.F. and Blankson,J.N.
TITLE Evolution of the HIV-1 nef gene in HLA-B*57 Positive Elite
Suppressors
JOURNAL Retrovirology 7 (1), 94 (2010)
PUBMED 21059238
FEATURES Location/Qualifiers
source 1..621
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="ES9provirus4"
/db_xref="taxon:11676"
/country="USA"
/note="collected 2004-2005"
gene 1..621
/gene="nef"
CDS 1..621
/gene="nef"
/codon_start="1"
/transl_table="1"
/product="nef protein"
/protein_id="ACK37931.1"
/db_xref="GI:217323043"
/translation="MGGKWSKSSVVGWPGVRERMRRAEPAADGVGAVSRDLEKHGAIT
SSNTAATNADCAWLEAQEEEEVGFPVRPQVPLRPMTYKGALDLSHFLKEKGGLEGLIH
SQRRQDILDLWVYNTQGYFPDWQNYTPGPGIRYPLTFGWCFKLVPVEPEKVEEANEGE
NNSLLHPMSLHGIEDPEKEVLVWRFDSRLAFHHVARELHPEYYKDC"
BASE COUNT 189 a 122 c 183 g 127 t
ORIGIN
1 atgggtggta agtggtcaaa aagtagtgtg gttggatggc ctggggtaag ggaaagaatg
61 agacgagctg agccagcagc agatggggtg ggagcagtat ctcgagacct ggaaaaacat
121 ggagcaatca caagtagcaa tacagcagct accaatgctg attgtgcctg gctagaagca
181 caagaggagg aggaggtggg ttttccagtc aggcctcaag tacctttaag accaatgact
241 tacaagggag ctttagatct tagccacttt ttaaaagaaa aggggggact ggaagggcta
301 attcactccc aaagaagaca agatatcctt gatctgtggg tctacaacac acaaggctac
361 ttccctgatt ggcagaacta cacaccaggg ccagggatca gatatccact gacctttgga
421 tggtgcttca agctagtacc agttgagcca gagaaggtag aagaggccaa tgaaggagag
481 aataacagct tgttacaccc tatgagcctg catgggatag aggacccgga gaaagaagtg
541 ttagtatgga ggtttgacag ccgcctggca tttcatcatg tagcccgaga gctgcatccg
601 gagtactaca aggactgctg a
//
last modified: Tue May 31 10:56 2022