HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    EU850296		     414 bp    DNA     linear	VRL 11-AUG-2009
DEFINITION  HIV-1 isolate 7 from Uganda envelope glycoprotein (env) gene,
	    partial cds
ACCESSION   EU850296
VERSION     EU850296.1 GI:212524211
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 414)
            Show all sequences for reference 1
  AUTHORS   Sacktor,N., Nakasujja,N., Skolasky,R.L., Rezapour,M., Robertson,K.,
	    Musisi,S., Katabira,E., Ronald,A., Clifford,D.B., Laeyendecker,O.
	    and Quinn,T.C.
  TITLE     HIV subtype D is associated with dementia, compared with subtype A,
	    in immunosuppressed individuals at risk of cognitive impairment in
	    Kampala, Uganda
  JOURNAL   Clin. Infect. Dis. 49 (5), 780-786 (2009)
  PUBMED    19622045
REFERENCE   2 (bases 1 to 414)
            Show all sequences for reference 2
  AUTHORS   Sacktor,N., Nakasujja,N., Skolasky,R.L., Rezapour,M., Robertson,K.,
	    Musisi,S., Katabira,E., Ronald,A., Clifford,D.B., Laeyendecker,O.
	    and Quinn,T.C.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-JUN-2008) Department of Neurology, Johns Hopkins
	    Bayview Medical Center, 4940 Eastern Ave, B. Bldg, Rm 123,
	    Baltimore, MD 21224, USA
FEATURES             Location/Qualifiers
     source	     1..414
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /isolate="7"
		     /isolation_source="female patient with Memorial Sloan
		     Kettering Dementia Scale (MKS) 2"
		     /db_xref="taxon:11676"
		     /country="Uganda: Kampala"
		     /note="samples were collected from Sept. 2005 to Jan. 2007
		     subtype: D/A1"
     gene	     <1..>414
		     /gene="env"
     CDS	     <1..>414
		     /gene="env"
		     /codon_start="1"
		     /transl_table="1"
		     /product="envelope glycoprotein"
		     /protein_id="ACJ26589.1"
		     /db_xref="GI:212524212"
		     /translation="SGIVQQQSNLLRAIEAQQQLLRLTVWGIKQLQARVLAVERYLKD
		     QQLLGIWGCSGKLICATNVPWNSSWSNRSQVEIWENMTWMQWEREIDNYTGFIYSLIE
		     ESQNQQEINEKDLLALDKWANLWSWFNITNWLWYIK"
BASE COUNT	138 a	  71 c	  104 g    101 t
ORIGIN
       1 tctggcatag tgcaacagca aagcaatttg ctgagggcta tagaggctca gcagcaactg 
      61 ttgagactca cagtctgggg cattaaacag ctccaggcaa gagtcctggc tgtggaaaga 
     121 tacctaaagg atcaacagct cctaggaatt tggggttgct ctggaaaact tatttgcgcc 
     181 actaacgtgc cttggaacag tagttggagc aataggtccc aagttgaaat ttgggaaaac 
     241 atgacctgga tgcagtggga acgagaaatt gacaattaca caggtttcat atacagctta 
     301 attgaagaat cgcaaaacca gcaagaaatt aatgaaaaag accttttggc attggataaa 
     361 tgggcaaact tgtggagttg gtttaatata acaaattggc tgtggtatat aaaa
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health