View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS EU841460 630 bp DNA linear VRL 15-SEP-2008
DEFINITION HIV-1 isolate 55 from Uganda gag protein (gag) gene, partial cds
ACCESSION EU841460
VERSION EU841460.1 GI:198444031
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 630)
Show all sequences for reference 1
AUTHORS Sacktor,N., Nakasujja,N., Skolasky,R.L., Rezapour,M., Robertson,K.,
Musisi,S., Katabira,E., Ronald,A., Clifford,D.B., Laeyendecker,O.
and Quinn,T.C.
TITLE Direct Submission
JOURNAL Submitted (20-JUN-2008) Department of Neurology, Johns Hopkins
Bayview Medical Center, 4940 Eastern Ave., B Bldg. Rm. 123,
Baltimore, MD 21224, USA
REFERENCE 2
Show all sequences for reference 2
AUTHORS Sacktor,N., Nakasujja,N., Skolasky,R.L., Rezapour,M., Robertson,K.,
Musisi,S., Katabira,E., Ronald,A., Clifford,D.B., Laeyendecker,O.
and Quinn,T.C.
TITLE HIV subtype D is associated with dementia, compared with subtype A,
in immunosuppressed individuals at risk of cognitive impairment in
Kampala, Uganda
JOURNAL Clin. Infect. Dis. 49 (5), 780-786 (2009)
PUBMED 19622045
FEATURES Location/Qualifiers
source 1..630
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="55"
/isolation_source="female patient"
/db_xref="taxon:11676"
/country="Uganda: Kampala"
/note="collected between Sep-2005 and Jan-2007; Memorial
Sloan Kettering Dementia Scale (MSK) = 0.5 subtype: A1/D"
gene <1..>630
/gene="gag"
CDS <1..>630
/gene="gag"
/codon_start="1"
/transl_table="1"
/product="gag protein"
/protein_id="ACH88198.1"
/db_xref="GI:198444032"
/translation="SPEVIPMFSALSEGATPQDLNTMLNAVGGHQAAMQMLKETINEE
AAEWDRLHPVQAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTSNPPIPVGEIYKRWI
ILGLNKIVRMYSPVSILDIRQGPKEPFRDYVDRFYKTLRAEQATQEVKNWMTETLLVQ
NANPDCKNILKALGSGATLEEMMTACQGVGGPSHKARVLAEAMSQAQQAN"
BASE COUNT 237 a 120 c 149 g 124 t
ORIGIN
1 agcccagaag taatacccat gttttcagca ttatcagaag gagccacccc acaagattta
61 aacaccatgc taaatgcagt ggggggacat caagcagcta tgcaaatgtt aaaagaaacc
121 atcaatgagg aagctgcaga atgggatagg ctacatccag tgcaggcagg acctattgca
181 ccaggccaaa tgagagaacc aaggggaagt gatatagcag gaactactag tacccttcag
241 gaacaaatag gatggatgac aagtaatcca cctatcccag taggagaaat ctataaaaga
301 tggataatcc taggattaaa taaaatagta agaatgtata gccctgtcag cattttggac
361 ataagacaag gaccaaagga accctttaga gattatgtag atcggttcta taaaactttg
421 agagccgagc aagctacaca ggaagtaaaa aattggatga ccgaaacctt gttggtccaa
481 aatgcgaacc cagattgtaa aaatatctta aaagcattag gatcaggggc tacattagaa
541 gaaatgatga cagcatgcca gggagtggga ggacccagcc ataaagcacg ggttttagct
601 gaggcaatga gtcaagcaca acaggcaaac
//
last modified: Tue May 31 10:56 2022