HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    EU636331		    1302 bp    RNA     linear	VRL 19-MAY-2008
DEFINITION  HIV-1 isolate 01-0512-2002/21/10 from USA pol protein (pol) gene,
	    partial cds
ACCESSION   EU636331
VERSION     EU636331.1 GI:188037047
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 1302)
            Show all sequences for reference 1
  AUTHORS   Little,S.J., Frost,S.D., Wong,J.K., Smith,D.M., Pond,S.L.,
	    Ignacio,C.C., Parkin,N.T., Petropoulos,C.J. and Richman,D.D.
  TITLE     Persistence of Transmitted Drug Resistance among Subjects with
	    Primary Human Immunodeficiency Virus Infection
  JOURNAL   J. Virol. 82 (11), 5510-5518 (2008)
  PUBMED    18353964
REFERENCE   2 (bases 1 to 1302)
            Show all sequences for reference 2
  AUTHORS   Little,S.J., Frost,S.D.W., Wong,J.K., Smith,D.M., Kosakovsky
	    Pond,S.L., Ignacio,C.C. and Richman,D.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-APR-2008) University Of California San Diego, 9500
	    Gilman Drive, La Jolla, CA 92093, USA
REFERENCE   3 (bases 1 to 1302)
            Show all sequences for reference 3
  AUTHORS   Parkin,N.T. and Pertopoulous,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-APR-2008) Monogram Biosciences, Inc, 345 Oyster Point
	    Blvd., South San Franscisco, CA 94080, USA
FEATURES             Location/Qualifiers
     source	     1..1302
		     /organism="Human immunodeficiency virus 1"
		     /mol_type="genomic RNA"
		     /isolate="01-0512-2002/21/10"
		     /db_xref="taxon:11676"
		     /country="USA"
		     /collection_date="21-Oct-2002"
     gene	     <1..>1302
		     /gene="pol"
     CDS	     <1..>1302
		     /gene="pol"
		     /note="contains protease and reverse transcriptase"
		     /codon_start="1"
		     /transl_table="1"
		     /product="pol protein"
		     /protein_id="ACD46176.1"
		     /db_xref="GI:188037048"
		     /translation="PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKP
		     KMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNFPIS
		     PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVF
		     AIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVP
		     LDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPD
		     IVIYQYMDDLYVGSDLEIGQHRIKIEELREHLLRWGFTTPDKKHQKEHPFLWMGYELH
		     PDKWTVQPIVLPEKDSWTVNDIQKLIGKLNWASQIYAGIKVRQLCKLLRGAKALTEIV
		     PLTREAELELAENREILKVPVHGVYYDPSKDLIAELQKQEQG"
BASE COUNT	509 a	 213 c	  279 g    301 t
ORIGIN
       1 cctcaaatca ctctttggca acgacccctt gtcacaataa agataggggg gcaactaaag 
      61 gaagctctat tagatacagg agcagatgat acagtattag aagacatgaa tttgccagga 
     121 agatggaaac caaaaatgat agggggaatt ggaggtttta tcaaagtaag acagtatgat 
     181 cagataccca tagaaatctg tgggcataaa gctataggta cagtgttaat aggacctaca 
     241 cctgtcaaca taattggaag aaatctgttg actcagcttg gttgcacctt aaattttcct 
     301 attagtccta ttgaaactgt accagtaaaa ttaaagccag gaatggatgg cccaaaagtt 
     361 aaacaatggc cattgacaga agaaaaaata aaagcattag tagaaatttg tacagaaatg 
     421 gaaaaggaag ggaaaatttc aaaaattggg cctgaaaatc catacaatac tccagtattt 
     481 gccataaaga aaaaagacag tactaaatgg agaaaattag tagatttcag agaacttaat 
     541 aagagaactc aagacttctg ggaagttcag ttaggaatac cacatcccgc agggttaaag 
     601 aagaataaat cagtaacagt actggatgtg ggtgatgcat atttttcagt tcccttagat 
     661 aaagacttca ggaagtacac tgcatttacc atacctagta taaacaatga gacaccaggg 
     721 attagatatc aatacaatgt gcttccacag ggatggaaag gatcaccagc aatcttccaa 
     781 tgtagcatga caaaaatctt agaacctttt aggaaacaaa atccagacat agttatctat 
     841 cagtacatgg atgatttgta tgtaggatct gacttagaaa tagggcaaca tagaataaaa 
     901 atagaggaac taagggaaca tttgttaagg tggggattta ccacaccaga caaaaaacat 
     961 cagaaagaac atccattcct ttggatgggt tatgaactcc atcctgataa atggacagta 
    1021 cagcctatag tgctgccaga aaaagacagc tggacggtca atgacataca gaagttaata 
    1081 gggaaattaa attgggcaag tcagatttat gcagggatta aagtaaggca attatgtaaa 
    1141 ctccttaggg gagccaaagc actaacagaa atagtaccac taacaagaga agcagagcta 
    1201 gaactggcag aaaacaggga gattctaaaa gtgccagtac atggagtgta ttatgaccca 
    1261 tcaaaagact taatagcaga attacagaag caggagcaag gc
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health