View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS EU346275 1092 bp RNA linear VRL 31-DEC-2008
DEFINITION HIV-1 isolate 440283_0_p2_3 from USA pol protein (pol) gene,
partial cds
ACCESSION EU346275
VERSION EU346275.1 GI:169635312
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 1092)
Show all sequences for reference 1
AUTHORS Agwu,A., Lindsey,J.C., Ferguson,K., Zhang,H., Spector,S.,
Rudy,B.J., Ray,S.C., Douglas,S.D., Flynn,P.M. and Persaud,D.
TITLE Analyses of HIV-1 drug-resistance profiles among infected
adolescents experiencing delayed antiretroviral treatment switch
after initial nonsuppressive highly active antiretroviral therapy.
JOURNAL AIDS Patient. Care. STDS.. 22(7); 545-52 (2008)
PUBMED 18479228
REFERENCE 2 (bases 1 to 1092)
Show all sequences for reference 2
AUTHORS Agwu,A., Lindsey,J., Ferguson,K., Zhang,H., Spector,S., Rudy,B.,
Ray,S.C., Douglas,S., Flynn,P. and Persaud,D.
TITLE Direct Submission
JOURNAL Submitted (14-DEC-2007) Pediatrics, Infectious Diseases, Johns
Hopkins University School of Medicine, 600 N. Wolfe Street, Park
256, Baltimore, MD 21287, USA
FEATURES Location/Qualifiers
source 1..1092
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="440283_0_p2_3"
/isolation_source="subject 440283 plasma drawn at 0 weeks"
/db_xref="taxon:11676"
/clone="p2_3"
/country="USA"
/note="PACTG trial 381"
gene <1..>1092
/gene="pol"
CDS <1..>1092
/gene="pol"
/note="contains PR and RT regions"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="ACA58428.1"
/db_xref="GI:169635313"
/translation="PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMDLPGRWKP
KMIGGIGGFIKVRQYDQIAIEICGHKVIGTVLIGPTPVNIIGRNLMTQLGCTLNFPIS
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPIF
AIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVP
LDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPD
LVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELH
PDKWTVQPIVLPEKDNWTVNDIQKLVGKLN"
BASE COUNT 423 a 184 c 231 g 254 t
ORIGIN
1 cctcaaatca ctctttggca acgacccctt gtcacagtaa agataggggg gcaactgaag
61 gaagctctat tagatacagg agcagatgat acagtattag aagaaatgga tctgccagga
121 agatggaaac caaaaatgat agggggaatt ggaggtttta tcaaagtaag acaatatgat
181 cagatagcca tagaaatctg tggacataaa gttataggta cagtattaat aggacctaca
241 cccgtcaaca taattggaag aaatctaatg actcagctag gttgcacttt aaattttccc
301 attagtccta ttgaaactgt accagtaaaa ttaaagccag gaatggatgg cccaaaagtt
361 aaacaatggc cattgacaga agaaaaaata aaagcattgg tggaaatttg tacagaaatg
421 gaaaaggaag gaaagatttc aaagattggg cctgaaaatc cctacaatac tccaatattt
481 gccataagga aaaaagatag tactaaatgg agaaaattag tagatttcag agagcttaat
541 aagagaactc aagacttctg ggaagttcaa ctaggaatac cacatcccgc agggttaaaa
601 cagaaaaaat cagtaacagt actagatgtg ggggatgcat atttttcagt tcccttagac
661 aaagaattca gaaagtatac tgcatttacc atacctagta caaataatga gacaccaggg
721 attagatatc agtacaatgt gcttccacag ggatggaaag gatcacccgc aatattccaa
781 agtagcatga caaaaatctt ggagcctttt agaaaacaaa atccagacct agttatctat
841 caatacatgg atgatctgta tgtaggatct gacttagaaa taggacagca tagaacaaaa
901 atagaggaac tgagacaaca tctgttgaag tgggggttta ccacaccaga caagaaacat
961 cagaaagaac ctccatttct ttggatgggc tatgagctcc atcctgataa atggacagta
1021 cagcctatag tgctgccaga aaaagacaac tggactgtca atgacataca gaagttagtg
1081 ggaaaattga at
//
last modified: Tue May 31 10:56 2022