View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS EF449952 971 bp RNA linear VRL 13-AUG-2008
DEFINITION HIV-1 isolate 1845456 from Switzerland pol protein (pol) gene,
partial cds
ACCESSION EF449952
VERSION EF449952.1 GI:134023505
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 971)
Show all sequences for reference 1
AUTHORS von Wyl,V., Yerly,S., Boni,J., Burgisser,P., Klimkait,T.,
Battegay,M., Furrer,H., Telenti,A., Hirschel,B., Vernazza,P.L.,
Bernasconi,E., Rickenbach,M., Perrin,L., Ledergerber,B. and
Gunthard,H.F.
CONSRTM for the Swiss HIV Cohort Study
TITLE Emergence of HIV-1 drug resistance in previously untreated patients
initiating combination antiretroviral treatment: a comparison of
different regimen types
JOURNAL Arch. Intern. Med. 167 (16), 1782-1790 (2007)
PUBMED 17846398
REFERENCE 2 (bases 1 to 971)
Show all sequences for reference 2
AUTHORS von Wyl,V., Yerly,S., Boeni,J., Buergisser,P., Klimkait,T.,
Battegay,M., Furrer,H., Telenti,A., Hirschel,B., Vernazza,P.L.,
Bernasconi,E., Rickenbach,M., Perrin,L., Ledergerber,B. and
Guenthard,H.F.
CONSRTM Swiss HIV Cohort Study
TITLE Direct Submission
JOURNAL Submitted (22-FEB-2007) Division of Infectious Diseases and
Hospital Epidemiology, University Hospital Zurich, Raemistrasse
100, Zurich CH-8091, Switzerland
FEATURES Location/Qualifiers
source 1..971
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="1845456"
/db_xref="taxon:11676"
/country="Switzerland"
/collection_date="2004"
gene <1..>971
/gene="pol"
CDS <1..>971
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="ABO45610.1"
/db_xref="GI:134023506"
/translation="PQITLWQRPLVTIRVAGQLKEALLDTGADDTVLEEINLPGNWKP
KMIGGIGGFIKVRQYDQILIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNFPIS
PIETVPVKLKPGMDGPRIKQWPLTEEKIKALTAICEEMEKEGKISKVGPENPYNTPVF
AIKKKDSTKWRKLVDFRELNKXTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVP
LDKSFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAKNPE
IVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEP"
BASE COUNT 382 a 160 c 205 g 223 t 1 other
ORIGIN
1 cctcaaatca ctctttggca gcgacccctt gtcacaataa gagtagctgg acagctaaag
61 gaggctctct tagacacagg ggcagatgat acagtattag aagaaataaa tttgccagga
121 aattggaaac caaaaatgat aggaggaatt ggaggtttta tcaaagtaag acagtatgat
181 caaatactta tagaaatttg tggaaaaaag gctataggta cagtattagt aggacctaca
241 cctgtcaaca taattggtag aaatctgttg actcagcttg gatgtacact aaattttcca
301 attagtccca tagaaactgt accagtaaaa ttgaagccag gaatggatgg cccaaggatt
361 aaacaatggc cattgacaga agaaaaaata aaagcattaa cagcaatttg tgaagagatg
421 gagaaggaag gaaaaatttc aaaagtaggg cccgaaaatc catataacac tccagtattt
481 gccataaaaa agaaggacag taccaagtgg agaaaattag tagatttcag ggaactcaat
541 aaargaactc aagacttttg ggaagttcaa ttagggatac cacacccagc agggttaaaa
601 aagaaaaaat cagtgacagt actagatgtg ggggatgcat atttctcagt tcctttagat
661 aaaagcttca ggaaatatac tgcattcacc atacctagtg taaacaatga aacaccaggg
721 attagatatc aatataatgt gcttccacag ggatggaaag gatcaccagc aatcttccag
781 tgtagcatga caaaaatctt agagcccttt agagcgaaaa acccagaaat agttatctat
841 caatatatgg atgacttata tgtaggctct gatttagaaa taggacaaca tagagcaaaa
901 atagaggagt taagagaaca cctattgaga tggggattta ccacaccaga caagaaacat
961 cagaaggaac c
//
last modified: Tue May 31 10:56 2022