View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS EF449897 971 bp RNA linear VRL 13-AUG-2008
DEFINITION HIV-1 isolate 693270 from Switzerland pol protein (pol) gene,
partial cds
ACCESSION EF449897
VERSION EF449897.1 GI:134023395
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 971)
Show all sequences for reference 1
AUTHORS von Wyl,V., Yerly,S., Boni,J., Burgisser,P., Klimkait,T.,
Battegay,M., Furrer,H., Telenti,A., Hirschel,B., Vernazza,P.L.,
Bernasconi,E., Rickenbach,M., Perrin,L., Ledergerber,B. and
Gunthard,H.F.
CONSRTM for the Swiss HIV Cohort Study
TITLE Emergence of HIV-1 drug resistance in previously untreated patients
initiating combination antiretroviral treatment: a comparison of
different regimen types
JOURNAL Arch. Intern. Med. 167 (16), 1782-1790 (2007)
PUBMED 17846398
REFERENCE 2 (bases 1 to 971)
Show all sequences for reference 2
AUTHORS von Wyl,V., Yerly,S., Boeni,J., Buergisser,P., Klimkait,T.,
Battegay,M., Furrer,H., Telenti,A., Hirschel,B., Vernazza,P.L.,
Bernasconi,E., Rickenbach,M., Perrin,L., Ledergerber,B. and
Guenthard,H.F.
CONSRTM Swiss HIV Cohort Study
TITLE Direct Submission
JOURNAL Submitted (22-FEB-2007) Division of Infectious Diseases and
Hospital Epidemiology, University Hospital Zurich, Raemistrasse
100, Zurich CH-8091, Switzerland
FEATURES Location/Qualifiers
source 1..971
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="693270"
/db_xref="taxon:11676"
/country="Switzerland"
/collection_date="2003"
gene <1..>971
/gene="pol"
CDS <1..>971
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="ABO45555.1"
/db_xref="GI:134023396"
/translation="PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKP
KMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNFPIS
PIETVPVRLKSGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPIF
AIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVP
LDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPD
LVIYQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEP"
BASE COUNT 388 a 153 c 196 g 231 t 3 other
ORIGIN
1 cctcaaatca ctctttggca acgacccctc gtcacaataa aggtaggggg gcagctaaag
61 gaagccctat tagatacagg agcagatgat acagtattag aagaaatgaa tttgccagga
121 agatggaaac caaaaatgat agggggtatt ggaggtttta tcaaagtaag gcagtatgat
181 cagatactca tagaaatctg tggacataaa gctataggta cagtattagt aggacctaca
241 cctgtcaata taattggaag aaatctgttg acccagattg gttgyacttt aaattttccc
301 attagtccta ttgaaactgt accagtaaga ttaaaatcag gaatggatgg cccaagagtt
361 aaacaatggc cattgacaga agagaaaata aaagcattaa cagaaatttg tacagaaatg
421 gaaaaggaag gaaaaatttc aaaaattggg cctgaaaatc catacaatac tccaatattt
481 gccataaara aaaaggacag tactaaatgg agaaaattag tagatttcag agaacttaat
541 aagaaaactc aagatttytg ggaggttcaa ttaggaatac cacatcctgc aggattaaaa
601 aagaaaaaat cagtaacagt actggatgtg ggtgatgcat atttttcagt tcccttagat
661 aaagacttca gaaagtatac tgcatttacc atacctagta taaacaatga aacaccaggg
721 attagatacc agtacaatgt gcttccgcag ggatggaaag gatcaccagc aatattccaa
781 agtagcatga caaaaatctt agaacccttt agaaaacaaa atccagactt agttatctat
841 caatacatgg atgatttgta tgtaggatct gacttagaaa taggacagca tagaacaaaa
901 atagaagaat tgagagaaca tctgttgaag tgggggttca ccacaccaga taaaaaacat
961 cagaaagaac c
//
last modified: Tue May 31 10:56 2022