View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS EF449891 971 bp RNA linear VRL 13-AUG-2008
DEFINITION HIV-1 isolate 4821915 from Switzerland pol protein (pol) gene,
partial cds
ACCESSION EF449891
VERSION EF449891.1 GI:134023383
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 971)
Show all sequences for reference 1
AUTHORS von Wyl,V., Yerly,S., Boni,J., Burgisser,P., Klimkait,T.,
Battegay,M., Furrer,H., Telenti,A., Hirschel,B., Vernazza,P.L.,
Bernasconi,E., Rickenbach,M., Perrin,L., Ledergerber,B. and
Gunthard,H.F.
CONSRTM for the Swiss HIV Cohort Study
TITLE Emergence of HIV-1 drug resistance in previously untreated patients
initiating combination antiretroviral treatment: a comparison of
different regimen types
JOURNAL Arch. Intern. Med. 167 (16), 1782-1790 (2007)
PUBMED 17846398
REFERENCE 2 (bases 1 to 971)
Show all sequences for reference 2
AUTHORS von Wyl,V., Yerly,S., Boeni,J., Buergisser,P., Klimkait,T.,
Battegay,M., Furrer,H., Telenti,A., Hirschel,B., Vernazza,P.L.,
Bernasconi,E., Rickenbach,M., Perrin,L., Ledergerber,B. and
Guenthard,H.F.
CONSRTM Swiss HIV Cohort Study
TITLE Direct Submission
JOURNAL Submitted (22-FEB-2007) Division of Infectious Diseases and
Hospital Epidemiology, University Hospital Zurich, Raemistrasse
100, Zurich CH-8091, Switzerland
FEATURES Location/Qualifiers
source 1..971
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="4821915"
/db_xref="taxon:11676"
/country="Switzerland"
/collection_date="2002"
gene <1..>971
/gene="pol"
CDS <1..>971
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="ABO45549.1"
/db_xref="GI:134023384"
/translation="PQITLWQRPIVTVRIGGQLKEALLDTGADDTVLEDMSLPGKWKP
KMIGGIGGFIKVRQYDQIPIEICGHKTIGTVLXGPTPVNIIGRNLLTQIGCTLNFPIS
PIETVPVKLKPGMDGPRXKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPIF
AIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIP
LDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPD
IVIYQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGLVTPDQKHQKEP"
BASE COUNT 380 a 160 c 202 g 225 t 4 other
ORIGIN
1 cctcagatca ctctttggca gcgacccatc gtcacagtaa ggataggggg gcaactaaag
61 gaagctctat tggatacagg agcagatgat acagtattag aagacatgag tttgccagga
121 aaatggaaac caaaaatgat aggaggaatt ggaggcttta tcaaagtaag acagtatgat
181 cagataccca tagaaatctg tgggcataaa actataggta cagtattart aggacctaca
241 cctgtcaaca taattggaag aaatctgttg actcagattg gctgcacttt aaattttccc
301 attagtccta ttgaaactgt accagtaaaa ttaaaaccag gaatggatgg cccaagartt
361 aaacaatggc cattgacaga agaaaaaata aaagcattag tagaaatttg tacagaaatg
421 gaaaaggaag gaaaaatttc aaaaattggg cctgaaaatc catacaatac tccaatattt
481 gccataaaga aaaaggacag tactaaatgg agaaaattag tagatttcag ggaacttaat
541 aagagaactc aagacttctg ggaagttcaa ttaggaatac cacatcccgg agggttaaaa
601 aagaaaaaat cagtaacagt actggatgtg ggtgatgcat atttctcaat tcccttagat
661 gaggacttca graagtatac tgcatttacc atacctagta caaayaatga gacaccagga
721 attagatatc aatacaatgt gcttccacag ggttggaaag gatcaccagc aatattccaa
781 agtagcatga caaaaatctt agagcctttt agaaaacaaa atccagacat agttatctat
841 caatacgtgg atgatttgta tgtaggatct gacttagaaa tagggcagca tagaacaaaa
901 gtagaggaac tgagacaaca tctgttgaag tggggattag tcaccccgga ccaaaaacat
961 cagaaagaac c
//
last modified: Tue May 31 10:56 2022