View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS DQ345996 627 bp DNA linear VRL 15-AUG-2006
DEFINITION Simian immunodeficiency virus isolate 1/52N.12-2 nef protein (nef)
gene, partial cds
ACCESSION DQ345996
VERSION DQ345996.1 GI:85680501
KEYWORDS .
SOURCE Simian immunodeficiency virus
ORGANISM Simian immunodeficiency virus Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 627)
Show all sequences for reference 1
AUTHORS Noel,R.J., Toro-Bahamonde,A., Marrero-Otero,Z., Orsini,S.,
Verma,A.S., Kumar,R. and Kumar,A.
TITLE Lack of correlation between SIV-Nef evolution and rapid disease
progression in morphine-dependent nonhuman primate model of AIDS.
JOURNAL AIDS Res. Hum. Retroviruses 22 (8), 817-23 (2006)
PUBMED 16910840
REFERENCE 2 (bases 1 to 627)
Show all sequences for reference 2
AUTHORS Noel,R.J. Jr.., Toro-Bahamonde,A., Marrero-Otero,Z., Kumar,R.,
Yamamura,Y. and Kumar,A.
TITLE Direct Submission
JOURNAL Submitted (21-DEC-2005) Biochemistry, Ponce School of Medicine, 395
Urb. Industrial Reparada, Zona 2, Ponce, PR 00716, USA
FEATURES Location/Qualifiers
source 1..627
/organism="Simian immunodeficiency virus"
/proviral="Simian immunodeficiency virus"
/mol_type="genomic DNA"
/isolate="1/52N.12-2"
/db_xref="taxon:11723"
gene 1..>627
/gene="nef"
CDS 1..>627
/gene="nef"
/codon_start="1"
/transl_table="1"
/product="nef protein"
/protein_id="ABC72451.1"
/db_xref="GI:85680502"
/translation="MGGAISMRRSRSSGDLRQRLLRARGETYGRLLGEVEDGYSQSPG
GLDKGLSSLSREGQKYNQEQYMNTPWRNPAKEREKLAYRKQNMDDIDEQDDDLVGVSV
RPKVPLRTMSYKLAIDISHFIKEKGGLEGIYYSARRHRILDIYLEKEKGIIPDWQDYT
SGPGIRFPKTFGRLWKLVPVNVSDEAQEDEEHYLMHPAQTSQWDDPWGE"
BASE COUNT 214 a 106 c 171 g 136 t
ORIGIN
1 atgggtggag ctatttccat gaggcggtcc aggtcgtctg gagatctgcg acagagactc
61 ttgcgggcgc gtggggagac ttatgggaga ctcttaggag aggtggaaga tggatactcg
121 caatccccag gaggattaga caagggcttg agctcactct ctcgtgaggg acaaaaatac
181 aatcaggagc agtatatgaa tactccatgg agaaacccag ctaaagagag agaaaaatta
241 gcatacagaa aacaaaatat ggatgatata gatgagcaag atgatgactt ggtaggggta
301 tcagtgaggc caaaagttcc cctaagaaca atgagttaca aattggcaat agacatatct
361 cattttataa aagaaaaggg gggactggaa gggatttatt acagtgcaag aagacataga
421 atcttagaca tatacttaga aaaggaaaaa ggcatcatac cagattggca ggattacacc
481 tcaggaccag gaattagatt cccaaagaca tttggtcggc tatggaaatt agtccctgta
541 aatgtatcag atgaggcaca ggaggatgag gagcattatt taatgcatcc agctcaaact
601 tcccagtggg atgacccttg gggagag
//
last modified: Tue May 31 10:56 2022