View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS DQ007715 300 bp RNA linear VRL 23-FEB-2006
DEFINITION Simian immunodeficiency virus isolate 04L12a2 tat protein (tat)
gene, complete cds
ACCESSION DQ007715
VERSION DQ007715.1 GI:63081395
KEYWORDS .
SOURCE Simian immunodeficiency virus
ORGANISM Simian immunodeficiency virus Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 300)
Show all sequences for reference 1
AUTHORS Noel,R.J. Jr.. and Kumar,A.
TITLE Virus replication and disease progression inversely correlate with
SIV tat evolution in morphine-dependent and SIV/SHIV-infected
Indian rhesus macaques
JOURNAL Virology 346 (1), 127-138 (2006)
PUBMED 16313937
REFERENCE 2 (bases 1 to 300)
Show all sequences for reference 2
AUTHORS Noel,R.J. Jr.. and Kumar,A.
TITLE Direct Submission
JOURNAL Submitted (14-APR-2005) Biochemistry, Ponce School of Medicine, PO
Box 7004, Ponce, PR 00732, USA
FEATURES Location/Qualifiers
source 1..300
/organism="Simian immunodeficiency virus"
/mol_type="genomic RNA"
/isolate="04L12a2"
/db_xref="taxon:11723"
gene 1..>300
/gene="tat"
CDS 1..300
/gene="tat"
/codon_start="1"
/transl_table="1"
/product="tat protein"
/protein_id="AAY30449.1"
/db_xref="GI:63081396"
/translation="METPLREQENSLESSNERSSCISEADASTPESANLGEEILSQLS
RPLEACYNTCYCKKCCYHCQFCFLKKGLGICYEQSRKRRRTPKKAKANTSSASNK"
exon 1..300
/gene="tat"
/number="1"
BASE COUNT 96 a 68 c 65 g 71 t
ORIGIN
1 atggagacac ccttgaggga gcaggagaac tcattagaat cctccaacga gcgctcttca
61 tgcatttcag aggcggatgc atccactcca gaatcggcca acctggggga ggaaatcctc
121 tctcagctat cccgccctct agaagcatgc tataacacat gttattgtaa aaagtgttgc
181 taccattgcc agttttgttt tcttaaaaaa ggcttgggga tatgttatga acaatcacga
241 aagagaagaa gaactccgaa aaaggctaag gctaatacat cttctgcatc aaacaagtaa
//
last modified: Tue May 31 10:56 2022