HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    AY834820		      93 bp    RNA     linear	VRL 23-MAR-2005
DEFINITION  HIV-1 clone 02202T0712mo.5 gag protein (gag) gene, partial cds
ACCESSION   AY834820
VERSION     AY834820.1 GI:57470857
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 93)
            Show all sequences for reference 1
  AUTHORS   Betts,M.R., Exley,B., Price,D.A., Bansal,A., Camacho,Z.T.,
	    Teaberry,V., West,S.M., Ambrozak,D.R., Tomaras,G., Roederer,M.,
	    Kilby,J.M., Tartaglia,J., Belshe,R., Gao,F., Douek,D.C.,
	    Weinhold,K.J., Koup,R.A., Goepfert,P. and Ferrari,G.
  TITLE     Characterization of functional and phenotypic changes in anti-Gag
	    vaccine-induced T cell responses and their role in protection after
	    HIV-1 infection
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 102 (12), 4512-4517 (2005)
  PUBMED    15753288
REFERENCE   2 (bases 1 to 93)
            Show all sequences for reference 2
  AUTHORS   Betts,M.R., Exley,B., Price,D.A., Bansal,A., Camacho,Z.T.,
	    Teaberry,V., West,S.M., Ambrozak,D.R., Tomaras,G., Roederero,M.,
	    Kilby,M.J., Tartaglia,J., Belshe,R., Gao,F., Douek,D.C.,
	    Weinhold,K.J., Koup,R.A., Goepfert,P. and Ferrari,G.
  TITLE     Failure of vaccine-induced HIV-specific T cell responses to protect
	    against HIV infection
  JOURNAL   Unpublished
REFERENCE   3 (bases 1 to 93)
            Show all sequences for reference 3
  AUTHORS   Betts,M.R., Exley,B., Price,D.A., Bansal,A., Camacho,Z.T.,
	    Teaberry,V., West,S.M., Ambrozak,D.R., Tomaras,G., Roederero,M.,
	    Kilby,M.J., Tartaglia,J., Belshe,R., Gao,F., Douek,D.C.,
	    Weinhold,K.J., Koup,R.A., Goepfert,P. and Ferrari,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-NOV-2004) Department of Surgery, Duke University
	    Medical Center, PO Box 2926, Durham, NC 27710, USA
FEATURES             Location/Qualifiers
     source	     1..93
		     /organism="Human immunodeficiency virus 1"
		     /mol_type="genomic RNA"
		     /isolation_source="patient 01202T07"
		     /db_xref="taxon:11676"
		     /clone="02202T0712mo.5"
		     /country="USA"
     gene	     <1..>93
		     /gene="gag"
     CDS	     <1..>93
		     /gene="gag"
		     /note="p24"
		     /codon_start="1"
		     /transl_table="1"
		     /product="gag protein"
		     /protein_id="AAW50753.1"
		     /db_xref="GI:57470858"
		     /translation="MTNNPPIPVGEIYKRWIILGLNKIVRMYSPT"
BASE COUNT	 39 a	  15 c	   16 g     23 t
ORIGIN
       1 atgacaaata atccacctat cccagtagga gaaatctata aaagatggat aatcctggga 
      61 ttaaataaaa tagtaaggat gtatagtcct acc
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health