View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY611321 450 bp DNA linear VRL 01-JUL-2004
DEFINITION HIV-1 isolate Ac-38 Day 64 1b1.fa from USA gag protein (gag) gene,
partial cds
ACCESSION AY611321
VERSION AY611321.1 GI:48927860
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 450)
Show all sequences for reference 1
AUTHORS Allen,T.M., Altfeld,M., Yu,X.G., O'Sullivan,K.M., Lichterfeld,M.,
Le Gall,S., John,M., Mothe,B.R., Lee,P.K., Kalife,E.T., Cohen,D.E.,
Freedberg,K.A., Strick,D.A., Johnson,M.N., Sette,A.,
Rosenberg,E.S., Mallal,S.A., Goulder,P.J.R., Brander,C. and
Walker,B.D.
TITLE Selection, Transmission, and Reversion of an Antigen-Processing
Cytotoxic T-Lymphocyte Escape Mutation in Human Immunodeficiency
Virus Type 1 Infection
JOURNAL J. Virol. 78 (13), 7069-7078 (2004)
PUBMED 15194783
REFERENCE 2 (bases 1 to 450)
Show all sequences for reference 2
AUTHORS Allen,T.M., Altfeld,M., Yu,X.G., O'Sullivan,K.M., Lichterfeld,M.,
Le Gall,S., John,M., Mothe,B.R., Lee,P.K., Kalife,E.T., Cohen,D.E.,
Freedberg,K.A., Strick,D.A., Johnson,M.N., Sette,A.,
Rosenberg,E.S., Mallal,S.A., Goulder,P.J.R., Brander,C. and
Walker,B.D.
TITLE Direct Submission
JOURNAL Submitted (28-APR-2004) Infectious Disease Division, Partners AIDS
Research Center and Massachusetts General Hospital, 149 13th
Street, Charlestown, MA 02129, USA
FEATURES Location/Qualifiers
source 1..450
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="Ac-38 Day 64 1b1.fa"
/db_xref="taxon:11676"
/country="USA"
gene 1..>450
/gene="gag"
CDS 1..>450
/gene="gag"
/codon_start="1"
/transl_table="1"
/product="gag protein"
/protein_id="AAT47642.1"
/db_xref="GI:48927861"
/translation="MGARASVLSGGELDRWEKIRLRPGGKKKYRLKHIVWASRELERF
ALNPGLLETSAGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQKIEVRDTKEALD
KIEEEQNKSKKKAQQAAADTGNSSQVSQNYPIVQNLQGQMVHQAISPR"
BASE COUNT 173 a 83 c 113 g 81 t
ORIGIN
1 atgggtgcga gagcgtcagt attaagcggg ggagaattag atagatggga aaaaattcgg
61 ttaaggccag ggggaaaaaa gaaatataga ttaaaacata tagtatgggc aagcagggaa
121 ctagaacgat tcgcacttaa tcctggcctg ttagaaacat cagcaggctg tagacaaata
181 ctgggacagc tacagccatc tcttcagaca ggatcagaag agcttcgatc attgtataat
241 acagtagcaa ccctctattg tgtacatcaa aagatagagg taagagacac caaggaagct
301 ttagacaaga tagaggaaga gcaaaataaa agtaagaaaa aggcacagca agcagcagct
361 gacacaggaa acagcagcca ggtcagccaa aattacccta tagtgcagaa cctccagggg
421 caaatggtac atcaggccat atcacctaga
//
last modified: Tue May 31 10:56 2022