View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY611259 125 bp DNA linear VRL 01-JUL-2004
DEFINITION HIV-1 isolate Ac-33 Day 482 1b8.fa from USA gag protein (gag) gene,
partial cds
ACCESSION AY611259
VERSION AY611259.1 GI:48927736
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 125)
Show all sequences for reference 1
AUTHORS Allen,T.M., Altfeld,M., Yu,X.G., O'Sullivan,K.M., Lichterfeld,M.,
Le Gall,S., John,M., Mothe,B.R., Lee,P.K., Kalife,E.T., Cohen,D.E.,
Freedberg,K.A., Strick,D.A., Johnson,M.N., Sette,A.,
Rosenberg,E.S., Mallal,S.A., Goulder,P.J.R., Brander,C. and
Walker,B.D.
TITLE Selection, Transmission, and Reversion of an Antigen-Processing
Cytotoxic T-Lymphocyte Escape Mutation in Human Immunodeficiency
Virus Type 1 Infection
JOURNAL J. Virol. 78 (13), 7069-7078 (2004)
PUBMED 15194783
REFERENCE 2 (bases 1 to 125)
Show all sequences for reference 2
AUTHORS Allen,T.M., Altfeld,M., Yu,X.G., O'Sullivan,K.M., Lichterfeld,M.,
Le Gall,S., John,M., Mothe,B.R., Lee,P.K., Kalife,E.T., Cohen,D.E.,
Freedberg,K.A., Strick,D.A., Johnson,M.N., Sette,A.,
Rosenberg,E.S., Mallal,S.A., Goulder,P.J.R., Brander,C. and
Walker,B.D.
TITLE Direct Submission
JOURNAL Submitted (28-APR-2004) Infectious Disease Division, Partners AIDS
Research Center and Massachusetts General Hospital, 149 13th
Street, Charlestown, MA 02129, USA
FEATURES Location/Qualifiers
source 1..125
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="Ac-33 Day 482 1b8.fa"
/db_xref="taxon:11676"
/country="USA"
gene 1..>125
/gene="gag"
CDS 1..>125
/gene="gag"
/codon_start="1"
/transl_table="1"
/product="gag protein"
/protein_id="AAT47580.1"
/db_xref="GI:48927737"
/translation="MGARASVLSGGELDKWEKIRLRPGSKKRYQIKHIVWASREL"
BASE COUNT 47 a 12 c 43 g 23 t
ORIGIN
1 atgggtgcga gagcgtcggt attaagcggg ggagaattag ataagtggga aaaaattcgg
61 ttaaggccag ggagtaagaa aagatatcag ataaaacata tagtatgggc aagcagggag
121 ctaga
//
last modified: Tue May 31 10:56 2022