View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY370096 288 bp DNA linear VRL 02-DEC-2005
DEFINITION HIV-1 isolate 25993P from Spain pol protein (pol) gene, partial cds
ACCESSION AY370096
VERSION AY370096.1 GI:34558990
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 288)
Show all sequences for reference 1
AUTHORS Chakraborty,B., Valer,L., de Mendoza,C., Soriano,V. and
Quinones-Mateu,M.E.
TITLE Failure to detect human immunodeficiency virus type 1
superinfection in 28 HIV-seroconcordant individuals with high risk
of reexposure to the virus
JOURNAL AIDS Res. Hum. Retroviruses 20 (9), 1026-1031 (2004)
PUBMED 15585092
REFERENCE 2 (bases 1 to 288)
Show all sequences for reference 2
AUTHORS Chakraborty,B., Valer,L., Tadele,M., Kiser,P., de Mendoza,C.,
Rangel,H.R., Weber,J., Mirza,M., Marotta,M.L., Stoddart,C.A.,
Soriano,V. and Quinines-Mateu,M.E.
TITLE Failure to Detect HIV-1 Superinfection in HIV-seroconcordant
individuals with High Risk of Re-exposure to the Virus. Is Fitness
Playing a Role in In Vivo HIV-1 Superinfection?
JOURNAL Unpublished
REFERENCE 3 (bases 1 to 288)
Show all sequences for reference 3
AUTHORS Chakraborty,B., Valer,L., Tadele,M., Kiser,P., de Mendoza,C.,
Rangel,H.R., Weber,J., Mirza,M., Marotta,M.L., Stoddart,C.A.,
Soriano,V. and Quinines-Mateu,M.E.
TITLE Direct Submission
JOURNAL Submitted (18-AUG-2003) Service of Infectious Diseases, Hospital
Carlos III, Sinesio Delgado 10, Madrid 28029, Spain
REFERENCE 4
Show all sequences for reference 4
AUTHORS Chakraborty,B., Kiser,P., Rangel,H.R., Weber,J., Mirza,M.,
Marotta,M.L., Asaad,R., Rodriguez,B., Valdez,H., Lederman,M.M. and
Quinones-Mateu,M.E.
TITLE Can HIV-1 superinfection compromise antiretroviral therapy?
JOURNAL AIDS 18 (1), 132-134 (2004)
PUBMED 15090842
FEATURES Location/Qualifiers
source 1..288
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="25993P"
/isolation_source="patient"
/db_xref="taxon:11676"
/country="Spain"
/note="subtype: B"
gene <1..>288
/gene="pol"
CDS <1..>288
/gene="pol"
/note="contains RT and protease"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="AAQ75259.1"
/db_xref="GI:34558991"
/translation="TLWQRPIXTIKVAGQQMEALLDTGADDTVLEEMDLPGKWKPRMI
GGIGGFAKVRQYDQIPIEICGHKVISTVLVGPTPANIVGRNLMTQIGCTLNF"
BASE COUNT 106 a 45 c 66 g 70 t 1 other
ORIGIN
1 actctttggc aacgacccat trtcacaata aaggtagcag ggcaacaaat ggaagctcta
61 ttagatacag gagcagatga tacagtatta gaagaaatgg acttgccagg aaaatggaaa
121 ccaagaatga tagggggaat tggaggtttt gccaaagtaa gacagtatga tcagataccc
181 atagaaatct gtggacataa agttataagt acagtattag taggacctac acctgccaac
241 atagttggaa gaaatctgat gactcagatt ggttgcactt taaatttt
//
last modified: Tue May 31 10:56 2022