HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    AY348365		     630 bp    RNA     linear	VRL 15-APR-2004
DEFINITION  HIV-1 isolate p2p158 clone 9 from USA envelope glycoprotein (env)
	    gene, partial cds
ACCESSION   AY348365
VERSION     AY348365.1 GI:33590683
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 630)
            Show all sequences for reference 1
  AUTHORS   Shankarappa,R., Margolick,J.B., Gange,S., Gange,S.J., Rodrigo,A.G.,
	    Upchurch,D., Farzadegan,H., Gupta,P., Rinaldo,C.R., Learn,G.H.,
	    He,X., Huang,X.-L. and Mullins,J.I.
  TITLE     Consistent viral evolutionary changes associated with the
	    progression of human immunodeficiency virus type 1 infection
  JOURNAL   J. Virol. 73 (12), 10489-10502 (1999)
  PUBMED    10559367
REFERENCE   2 (bases 1 to 630)
            Show all sequences for reference 2
  AUTHORS   Shriner,D., Shankarappa,R., Jensen,M.A., Nickle,D.C., Mittler,J.E.,
	    Margolick,J.B. and Mullins,J.I.
  TITLE     Influence of Random Genetic Drift on Human Immunodeficiency Virus
	    Type 1 env Evolution During Chronic Infection
  JOURNAL   Genetics 166 (3), 1155-1164 (2004)
  PUBMED    15082537
REFERENCE   3 (bases 1 to 630)
            Show all sequences for reference 3
  AUTHORS   Shriner,D., Shankarappa,R., Jensen,M.A., Nickle,D.C., Mittler,J.E.,
	    Margolick,J.B. and Mullins,J.I.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JUL-2003) Department of Microbiology, University of
	    Washington, Box 358070, Seattle, WA 98195-8070, USA
REFERENCE   4
            Show all sequences for reference 4
  AUTHORS   Jensen,M.A., Li,F., van 't Wout,A.B., Nickle,D.C., Shriner,D.,
	    He,H.-X., McLaughlin,S., Shankarappa,R., Margolick,J.B. and
	    Mullins,J.I.
  CONSRTM   Multicenter AIDS Cohort Study
  TITLE     Improved Coreceptor Usage Prediction and Genotypic Monitoring of
	    R5-to-X4 Transition by Motif Analysis of Human Immunodeficiency
	    Virus Type 1 env V3 Loop Sequences
  JOURNAL   J. Virol. 77 (24), 13376-13388 (2003)
  PUBMED    14645592
COMMENT     Sequences AF204402-204670, AF137629-138703, and AY348544-348333:
	    the 3-digit number in each sample name is months
	    post-seroconversion. Sampling years are estimated based on
	    enrollment in 1983-84 incremented by months post-seroconversion.
	    Data on viral load, CD4, and CD8 provided by J. Mullins [JM 3/06]
FEATURES             Location/Qualifiers
     source	     1..630
		     /organism="Human immunodeficiency virus 1"
		     /mol_type="genomic RNA"
		     /isolate="p2p158"
		     /db_xref="taxon:11676"
		     /clone="9"
		     /country="USA"
     gene	     <1..>630
		     /gene="env"
		     /note="gp120"
     CDS	     <1..>630
		     /gene="env"
		     /codon_start="1"
		     /transl_table="1"
		     /product="envelope glycoprotein"
		     /protein_id="AAQ22804.1"
		     /db_xref="GI:33590684"
		     /translation="EEEVVVRSQNFSNNAKTIIVQLKDAVEINCTRPNNNTRKSIHLG
		     LGRAFYATDNIIGDTRQAHCNISKTKWNDTLKKVVEKLGEQFRNTTRIVFNQSSGGDP
		     EIVMHSFNCGGEFFYCNTTKLFYSTWDKSNSTGVNGNGPWNATKMPNNNGETIILPCK
		     IKQIINMWQEVGKAMYAPPIRGQIRCSSNITGLLLTSDGGGNTNETFGPG"
BASE COUNT	252 a	  97 c	  130 g    151 t
ORIGIN
       1 gaagaagagg tagtagttag gtctcaaaat ttctcgaaca atgctaaaac cataatagta 
      61 cagctgaagg acgctgtaga aattaattgt acaagaccca acaacaatac aagaaaaagt 
     121 atacatttag gactagggag agcattttat gcaacagaca acataatagg agatacaaga 
     181 caagcacatt gtaacattag taaaacaaaa tggaatgaca ctttaaaaaa ggtagttgaa 
     241 aaattaggcg aacaatttag gaatacaaca agaatagtct ttaatcaatc ctcaggaggg 
     301 gacccagaaa ttgtaatgca cagttttaat tgtggagggg aatttttcta ctgtaataca 
     361 acaaaactgt tttatagtac ttgggacaag agtaatagta ctggggttaa tggtaatggt 
     421 ccttggaatg ctactaaaat gccaaataac aatggagaaa ctatcatact cccatgcaaa 
     481 ataaaacaaa ttataaacat gtggcaggaa gtaggaaaag caatgtatgc ccctcccatc 
     541 agaggacaaa ttagatgttc atcaaatatt acagggctgc tactaacaag cgatggtggt 
     601 ggtaatacga atgagacctt cggacctgga 
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health