View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY282073 405 bp DNA linear VRL 16-DEC-2004
DEFINITION HIV-1 clone SUMA004-007 gag protein (gag) gene, partial cds
ACCESSION AY282073
VERSION AY282073.1 GI:34421372
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 405)
Show all sequences for reference 1
AUTHORS Jones,N.A., Wei,X., Flower,D.R., Wong,M., Michor,F., Saag,M.S.,
Hahn,B.H., Nowak,M.A., Shaw,G.M. and Borrow,P.
TITLE Determinants of human immunodeficiency virus type 1 escape from the
primary CD8+ cytotoxic T lymphocyte response
JOURNAL J. Exp. Med. 200 (10), 1243-1256 (2004)
PUBMED 15545352
REFERENCE 2 (bases 1 to 405)
Show all sequences for reference 2
AUTHORS Jones,N.A., Wei,X., Flower,D.R., Wong,M., Michor,F., Saag,M.S.,
Hahn,B.H., Nowak,M.A., Shaw,G.M. and Borrow,P.
TITLE Direct Submission
JOURNAL Submitted (22-APR-2003) The Edward Jemmer Institute for Vaccine
Research, Copton, Newbury, Berkshire RG20 7NN, UK
REFERENCE 3
Show all sequences for reference 3
AUTHORS Decker,J.M., Bibollet-Ruche,F., Wei,X., Wang,S., Levy,D.N.,
Wang,W., Delaporte,E., Peeters,M., Derdeyn,C.A., Allen,S.,
Hunter,E., Saag,M.S., Hoxie,J.A., Hahn,B.H., Kwong,P.D.,
Robinson,J.E. and Shaw,G.M.
TITLE Antigenic conservation and immunogenicity of the HIV coreceptor
binding site
JOURNAL J. Exp. Med. 201 (9), 1407-1419 (2005)
PUBMED 15867093
COMMENT For sequences from this patient, the first number in the sequence
name indicates the number of days since onset of symptoms; this
number was used as the basis of days post-seroconversion.
FEATURES Location/Qualifiers
source 1..405
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/db_xref="taxon:11676"
/clone="SUMA004-007"
/note="clones are labeled as patientxxx-yyy, where xxx is
the number of days after DFOSx and yyy is the clone
number"
gene <1..>405
/gene="gag"
CDS <1..>405
/gene="gag"
/codon_start="1"
/transl_table="1"
/product="gag protein"
/protein_id="AAQ67924.1"
/db_xref="GI:34421373"
/translation="MGARASVLSGGELDRWEKIRLRPGGKKKYQLKHIVWASRELERF
AVNPGLLETSEGCRQILGQLQPALQTGSEELKSLYNTVATLYCVHQKIDVKDTKEALD
KIEEEQNKSKKKAQQAAADAGNNSQVSQNYPIV"
BASE COUNT 164 a 68 c 100 g 73 t
ORIGIN
1 atgggtgcga gagcgtcagt attaagcggg ggagaattag atagatggga aaaaattcgg
61 ttaaggccag ggggaaagaa aaaatatcaa ttaaaacata tagtatgggc aagcagggag
121 ctagaacgat tcgcagttaa ccctggcctg ttagaaacat cagaaggatg tagacaaata
181 ctgggacagc tacaaccagc ccttcagaca ggatcagaag aacttaaatc attatataat
241 acagtagcga ccctctattg tgtgcatcaa aagatagatg taaaagatac caaggaagct
301 ttagataaga tagaggaaga gcaaaacaaa agtaagaaaa aagcacagca agcagcagct
361 gacgcaggaa acaacagcca ggtcagccaa aattacccta tagtg
//
last modified: Tue May 31 10:56 2022