HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    AY282068		     405 bp    DNA     linear	VRL 16-DEC-2004
DEFINITION  HIV-1 clone SUMA004-002 gag protein (gag) gene, partial cds
ACCESSION   AY282068
VERSION     AY282068.1 GI:34421362
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 405)
            Show all sequences for reference 1
  AUTHORS   Jones,N.A., Wei,X., Flower,D.R., Wong,M., Michor,F., Saag,M.S.,
	    Hahn,B.H., Nowak,M.A., Shaw,G.M. and Borrow,P.
  TITLE     Determinants of human immunodeficiency virus type 1 escape from the
	    primary CD8+ cytotoxic T lymphocyte response
  JOURNAL   J. Exp. Med. 200 (10), 1243-1256 (2004)
  PUBMED    15545352
REFERENCE   2 (bases 1 to 405)
            Show all sequences for reference 2
  AUTHORS   Jones,N.A., Wei,X., Flower,D.R., Wong,M., Michor,F., Saag,M.S.,
	    Hahn,B.H., Nowak,M.A., Shaw,G.M. and Borrow,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2003) The Edward Jemmer Institute for Vaccine
	    Research, Copton, Newbury, Berkshire RG20 7NN, UK
REFERENCE   3
            Show all sequences for reference 3
  AUTHORS   Decker,J.M., Bibollet-Ruche,F., Wei,X., Wang,S., Levy,D.N.,
	    Wang,W., Delaporte,E., Peeters,M., Derdeyn,C.A., Allen,S.,
	    Hunter,E., Saag,M.S., Hoxie,J.A., Hahn,B.H., Kwong,P.D.,
	    Robinson,J.E. and Shaw,G.M.
  TITLE     Antigenic conservation and immunogenicity of the HIV coreceptor
	    binding site
  JOURNAL   J. Exp. Med. 201 (9), 1407-1419 (2005)
  PUBMED    15867093
COMMENT     For sequences from this patient, the first number in the sequence
	    name indicates the number of days since onset of symptoms; this
	    number was used as the basis of days post-seroconversion.
FEATURES             Location/Qualifiers
     source	     1..405
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /db_xref="taxon:11676"
		     /clone="SUMA004-002"
		     /note="clones are labeled as patientxxx-yyy, where xxx is
		     the number of days after DFOSx and yyy is the clone
		     number"
     gene	     <1..>405
		     /gene="gag"
     CDS	     <1..>405
		     /gene="gag"
		     /codon_start="1"
		     /transl_table="1"
		     /product="gag protein"
		     /protein_id="AAQ67919.1"
		     /db_xref="GI:34421363"
		     /translation="MGARASVLSGGELDRWEKIRLRPGGKKKYQLKHIVWASRELERF
		     AVNPGLLETSEGCRQILGQLQPALQTGSEELKSLYNTVATLYCVHQKIDVKDTKEALD
		     KIEEEPNKSKKKAQQAAADAGNNSQVSQNYPIV"
BASE COUNT	163 a	  69 c	  100 g     73 t
ORIGIN
       1 atgggtgcga gagcgtcagt attaagcggg ggagaattag atagatggga aaaaattcgg 
      61 ttaaggccag ggggaaagaa aaaatatcaa ttaaaacata tagtatgggc aagcagggag 
     121 ctagaacgat tcgcagttaa ccctggcctg ttagaaacat cagaaggatg tagacaaata 
     181 ctgggacagc tacaaccagc ccttcagaca ggatcagaag aacttaaatc attatataat 
     241 acagtagcga ccctctattg tgtgcatcaa aagatagatg taaaagatac caaggaagct 
     301 ttagataaga tagaggaaga gccaaacaaa agtaagaaaa aagcacagca agcagcagct 
     361 gacgcaggaa acaacagcca ggtcagccaa aattacccta tagtg
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health