HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    AY156894		     775 bp    DNA     linear	VRL 22-OCT-2002
DEFINITION  HIV-1 clone V37 from USA envelope glycoprotein (env) gene, partial
	    cds
ACCESSION   AY156894
VERSION     AY156894.1 GI:24210257
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 775)
            Show all sequences for reference 1
  AUTHORS   Metzker,M.L., Ansari-Lari,M.A., Liu,X.M., Holder,D.J. and
	    Gibbs,R.A.
  TITLE     Quantitation of mixed-base populations of HIV-1 variants by
	    automated DNA sequencing with BODIPY dye-labeled primers
  JOURNAL   BioTechniques 25 (3), 446-447 (1998)
  PUBMED    9762443
REFERENCE   2 (bases 1 to 775)
            Show all sequences for reference 2
  AUTHORS   Metzker,M.L., Mindell,D.P., Liu,X.M., Ptak,R.G., Gibbs,R.A. and
	    Hillis,D.M.
  TITLE     Molecular evidence of HIV-1 transmission in a criminal case.
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (22), 14292-7 (2002)
  PUBMED    12388776
REFERENCE   3 (bases 1 to 775)
            Show all sequences for reference 3
  AUTHORS   Metzker,M.L., Liu,X.-M. and Gibbs,R.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-SEP-2002) Department of Molecular & Human Genetics,
	    Baylor College of Medicine, One Baylor Plaza, N1409, Houston, TX
	    77030, USA
COMMENT     There are 174 sequences in this group. A control group comprised of
	    28 individuals includes 26 env and 25 RT sequences taken in 1995.
	    Patient samples (66) include 51 env and 7 RT from 1995
	    (BCM,P01-50), 2 env and 6 RT from 1997 (MIC). Victim samples (57)
	    include 51 env and 2RT from 1995 (BCM,V01-50), and 2 env and 2 RT
	    from 1997 (MIC). This was a criminal case where a physician
	    intentionally infected the "victim" by intramuscular injection of
	    blood from the "patient". Victim was injected August, 1994 and
	    was seropositive in January, 1995.
FEATURES             Location/Qualifiers
     source	     1..775
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /isolation_source="whole blood PBMC"
		     /db_xref="taxon:11676"
		     /clone="V37"
		     /country="USA: Lafayette, LA"
     gene	     <1..>775
		     /gene="env"
     CDS	     <1..>775
		     /gene="env"
		     /codon_start="2"
		     /transl_table="1"
		     /product="envelope glycoprotein"
		     /protein_id="AAN41621.1"
		     /db_xref="GI:24210258"
		     /translation="IRPTVSTQLLLSGSLAEKEVVIRSENFTNNAKTIIVQLKTPVEI
		     NCTRPNNNTRKSISIGPGRALYTTGDIIGDIRKAYCNISKAKWNDTLSQVVKKLGQQF
		     NKTTIVFKQSSGGDPEIAMHSFNCGGEFFYCNTTQLFNSTWNITEETNNMEGNNTTIT
		     LPCRIKQMINMWQEVGKAMYAPPIQGIISCSSNITGLLLTRDGGNGNDTRDNETFRPG
		     GGDMKDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKR"
BASE COUNT	331 a	 123 c	  157 g    164 t
ORIGIN
       1 aattaggcca acagtatcaa ctcaattact gttaagtggc agtctagcag aaaaagaggt 
      61 agtaattaga tctgaaaatt tcacgaacaa tgctaaaacc ataatagtac agctgaaaac 
     121 acctgtagaa attaattgta caaggcccaa caacaataca agaaaaagta tatctatagg 
     181 accagggaga gcactttata caacaggaga cataatagga gatataagaa aagcatattg 
     241 taacattagt aaagcaaaat ggaatgacac tctaagccag gtagttaaaa aattaggaca 
     301 acaatttaat aaaacaacaa tagtctttaa gcaatcctca ggaggggacc cagaaattgc 
     361 aatgcacagt tttaactgtg gaggggaatt tttctactgt aatacaacac aactgtttaa 
     421 tagtacctgg aatattactg aagaaacaaa taacatggaa ggaaataata caacaatcac 
     481 actcccatgc agaataaaac aaatgataaa catgtggcag gaggtaggaa aagcaatgta 
     541 tgccccgccc atccaaggaa taattagctg ctcatcaaat attacagggc tactactaac 
     601 aagagatggc ggtaatggta atgacaccag agataatgag accttcagac ctggaggagg 
     661 agatatgaag gacaattgga gaagtgaatt atataaatat aaagtagtaa aaattgaacc 
     721 attaggagta gcacccacca aggcaaagag aagggtggtg caaagagaaa aaaga
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health