HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    AY156811		     763 bp    DNA     linear	VRL 22-OCT-2002
DEFINITION  HIV-1 clone P04 from USA envelope glycoprotein (env) gene, partial
	    cds
ACCESSION   AY156811
VERSION     AY156811.1 GI:24210091
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 763)
            Show all sequences for reference 1
  AUTHORS   Metzker,M.L., Mindell,D.P., Liu,X.M., Ptak,R.G., Gibbs,R.A. and
	    Hillis,D.M.
  TITLE     Molecular evidence of HIV-1 transmission in a criminal case.
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (22), 14292-7 (2002)
  PUBMED    12388776
REFERENCE   2 (bases 1 to 763)
            Show all sequences for reference 2
  AUTHORS   Metzker,M.L., Liu,X.-M. and Gibbs,R.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-SEP-2002) Department of Molecular & Human Genetics,
	    Baylor College of Medicine, One Baylor Plaza, N1409, Houston, TX
	    77030, USA
COMMENT     There are 174 sequences in this group. A control group comprised of
	    28 individuals includes 26 env and 25 RT sequences taken in 1995.
	    Patient samples (66) include 51 env and 7 RT from 1995
	    (BCM,P01-50), 2 env and 6 RT from 1997 (MIC). Victim samples (57)
	    include 51 env and 2RT from 1995 (BCM,V01-50), and 2 env and 2 RT
	    from 1997 (MIC). This was a criminal case where a physician
	    intentionally infected the "victim" by intramuscular injection of
	    blood from the "patient". Victim was injected August, 1994 and
	    was seropositive in January, 1995.
FEATURES             Location/Qualifiers
     source	     1..763
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /isolation_source="whole blood PBMC"
		     /db_xref="taxon:11676"
		     /clone="P04"
		     /country="USA: Lafayette, LA"
     gene	     <1..>763
		     /gene="env"
     CDS	     <1..>763
		     /gene="env"
		     /codon_start="2"
		     /transl_table="1"
		     /product="envelope glycoprotein"
		     /protein_id="AAN41538.1"
		     /db_xref="GI:24210092"
		     /translation="IRPTVSTQLLLNGSLAEEEVVIRSENFTNNAKTIIVQLKEPVEI
		     NCTRPNNNTRKRITTGPGRVLYTTGEIIGNIRKAYCNISKAKWNNTLGQIAEKLREQF
		     NKTIIFNQSSGGDPEIVMHSFNCGGEFFYCNTSQLFNSTWNSTKKENNTTGDTIITLP
		     CKIKQIINMWQEVGKAMYAPPIQGIIRCSSNVTGLLLTRDGGENNATNETFRPGGGNM
		     RDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKR"
BASE COUNT	332 a	 120 c	  150 g    161 t
ORIGIN
       1 aattaggcca acagtatcaa ctcaattact gctaaatggc agtctagcag aagaagaggt 
      61 agtaattaga tctgaaaatt tcacgaacaa tgctaaaacc ataatagtac agctgaaaga 
     121 acctgtagaa attaattgta caagacccaa caacaataca agaaaaagga taactacagg 
     181 accagggaga gtactttaca caacaggaga aataatagga aatataagaa aagcatattg 
     241 taacattagt aaagcaaaat ggaataacac tctaggacag atagctgaaa aattaagaga 
     301 acaatttaat aaaacaataa tctttaatca atcctcagga ggggacccag aaattgtaat 
     361 gcacagtttt aactgtggag gggaattttt ctactgtaat acatcacaac tgtttaatag 
     421 tacctggaat agtactaaaa aagaaaataa cacgacagga gataccataa tcacactccc 
     481 atgcaaaata aaacaaatta taaacatgtg gcaggaagta ggaaaagcaa tgtatgcccc 
     541 tcccatccaa ggaataatta gatgctcatc aaatgttaca gggctactac taacaagaga 
     601 tggtggtgag aacaacgcta ctaatgagac cttcagacct ggaggaggaa atatgaggga 
     661 caattggaga agtgaattat ataaatataa agtagtaaaa attgaaccat taggagtagc 
     721 acccaccaag gcaaagagaa gggtggtgca aagagaaaaa aga
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health