HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    AY156777		     689 bp    DNA     linear	VRL 22-OCT-2002
DEFINITION  HIV-1 clone LA10.RT from USA reverse transcriptase (pol) gene,
	    partial cds
ACCESSION   AY156777
VERSION     AY156777.1 GI:24209969
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 689)
            Show all sequences for reference 1
  AUTHORS   Metzker,M.L., Mindell,D.P., Liu,X.M., Ptak,R.G., Gibbs,R.A. and
	    Hillis,D.M.
  TITLE     Molecular evidence of HIV-1 transmission in a criminal case.
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (22), 14292-7 (2002)
  PUBMED    12388776
REFERENCE   2 (bases 1 to 689)
            Show all sequences for reference 2
  AUTHORS   Metzker,M.L., Liu,X.-M. and Gibbs,R.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-SEP-2002) Department of Molecular & Human Genetics,
	    Baylor College of Medicine, One Baylor Plaza, N1409, Houston, TX
	    77030, USA
COMMENT     LA02-LA32 include 1 env and 1 RT sequence for each patient, and are
	    the control group used to represent the population of a
	    metropolitan area, Lafayette, LA. There are 174 sequences in this
	    group. A control group comprised of 28 individuals includes 26 env
	    and 25 RT sequences taken in 1995. Patient samples (66) include 51
	    env and 7 RT from 1995 (BCM,P01-50), 2 env and 6 RT from 1997
	    (MIC). Victim samples (57) include 51 env and 2RT from 1995
	    (BCM,V01-50), and 2 env and 2 RT from 1997 (MIC). This was a
	    criminal case where a physician intentionally infected the
	    "victim" by intramuscular injection of blood from the
	    "patient". Victim was injected August, 1994 and was seropositive
	    in January, 1995.
FEATURES             Location/Qualifiers
     source	     1..689
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /isolation_source="whole blood PBMC"
		     /db_xref="taxon:11676"
		     /clone="LA10.RT"
		     /country="USA: Lafayette, LA"
     gene	     <1..>689
		     /gene="pol"
     CDS	     <1..>689
		     /gene="pol"
		     /codon_start="1"
		     /transl_table="1"
		     /product="reverse transcriptase"
		     /protein_id="AAN41477.1"
		     /db_xref="GI:24209970"
		     /translation="PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKE
		     GKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKK
		     KKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIF
		     QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPD
		     KKHQKEPPFLW"
BASE COUNT	281 a	 117 c	  134 g    157 t
ORIGIN
       1 cccattagtc ctattgaaac tgtaccagta aaattaaagc caggaatgga tggcccaaaa 
      61 gttaaacaat ggccattgac agaagaaaaa ataaaagcat tagtagaaat ttgtacagaa 
     121 atggagaagg aaggaaaaat ttcaaaaatt gggcctgaaa atccatacaa tactccagta 
     181 tttgccataa agaaaaaaga cagtactaaa tggagaaaat tagtagattt cagagaactt 
     241 aataagagaa ctcaagactt ctgggaagtt caattaggaa taccacatcc tgcagggcta 
     301 aaaaagaaaa aatcagtaac agtactggat gtgggtgatg catatttttc agttccctta 
     361 gacaaagact tcaggaagta tactgcattt accataccta gtgtaaacaa tgagacacca 
     421 gggattagat atcagtacaa tgtgcttcca cagggatgga aaggatcacc agcaatattc 
     481 caaagtagca tgacaaaaat cttagagcct tttagaaaac aaaacccaga catagtcatc 
     541 taccaataca tggatgattt gtatgtagga tctgatttag aaatagggca gcatagaaca 
     601 aaaatagagg aactgagaca acatctgttg aagtggggat ttaccacacc agacaaaaaa 
     661 catcagaaag aacccccatt cctttggat
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health