View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY156777 689 bp DNA linear VRL 22-OCT-2002
DEFINITION HIV-1 clone LA10.RT from USA reverse transcriptase (pol) gene,
partial cds
ACCESSION AY156777
VERSION AY156777.1 GI:24209969
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 689)
Show all sequences for reference 1
AUTHORS Metzker,M.L., Mindell,D.P., Liu,X.M., Ptak,R.G., Gibbs,R.A. and
Hillis,D.M.
TITLE Molecular evidence of HIV-1 transmission in a criminal case.
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (22), 14292-7 (2002)
PUBMED 12388776
REFERENCE 2 (bases 1 to 689)
Show all sequences for reference 2
AUTHORS Metzker,M.L., Liu,X.-M. and Gibbs,R.A.
TITLE Direct Submission
JOURNAL Submitted (27-SEP-2002) Department of Molecular & Human Genetics,
Baylor College of Medicine, One Baylor Plaza, N1409, Houston, TX
77030, USA
COMMENT LA02-LA32 include 1 env and 1 RT sequence for each patient, and are
the control group used to represent the population of a
metropolitan area, Lafayette, LA. There are 174 sequences in this
group. A control group comprised of 28 individuals includes 26 env
and 25 RT sequences taken in 1995. Patient samples (66) include 51
env and 7 RT from 1995 (BCM,P01-50), 2 env and 6 RT from 1997
(MIC). Victim samples (57) include 51 env and 2RT from 1995
(BCM,V01-50), and 2 env and 2 RT from 1997 (MIC). This was a
criminal case where a physician intentionally infected the
"victim" by intramuscular injection of blood from the
"patient". Victim was injected August, 1994 and was seropositive
in January, 1995.
FEATURES Location/Qualifiers
source 1..689
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolation_source="whole blood PBMC"
/db_xref="taxon:11676"
/clone="LA10.RT"
/country="USA: Lafayette, LA"
gene <1..>689
/gene="pol"
CDS <1..>689
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="reverse transcriptase"
/protein_id="AAN41477.1"
/db_xref="GI:24209970"
/translation="PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKE
GKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKK
KKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPD
KKHQKEPPFLW"
BASE COUNT 281 a 117 c 134 g 157 t
ORIGIN
1 cccattagtc ctattgaaac tgtaccagta aaattaaagc caggaatgga tggcccaaaa
61 gttaaacaat ggccattgac agaagaaaaa ataaaagcat tagtagaaat ttgtacagaa
121 atggagaagg aaggaaaaat ttcaaaaatt gggcctgaaa atccatacaa tactccagta
181 tttgccataa agaaaaaaga cagtactaaa tggagaaaat tagtagattt cagagaactt
241 aataagagaa ctcaagactt ctgggaagtt caattaggaa taccacatcc tgcagggcta
301 aaaaagaaaa aatcagtaac agtactggat gtgggtgatg catatttttc agttccctta
361 gacaaagact tcaggaagta tactgcattt accataccta gtgtaaacaa tgagacacca
421 gggattagat atcagtacaa tgtgcttcca cagggatgga aaggatcacc agcaatattc
481 caaagtagca tgacaaaaat cttagagcct tttagaaaac aaaacccaga catagtcatc
541 taccaataca tggatgattt gtatgtagga tctgatttag aaatagggca gcatagaaca
601 aaaatagagg aactgagaca acatctgttg aagtggggat ttaccacacc agacaaaaaa
661 catcagaaag aacccccatt cctttggat
//
last modified: Tue May 31 10:56 2022